Clone BO27111 Report

Search the DGRC for BO27111

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:11
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27111.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO27111.complete Sequence

271 bp assembled on 2010-08-18

> BO27111.complete
GAAGTTATCAGTCGACATGGTAACACGAATTGATACTGCGTTGATTTGGA
TCGTTGAACACAGTTACATACGTTACATTTTGCACGTTTTCTATTGCGAT
TTACAATTAGTTTTGCCAGTTCACACAATCTCCTTTGATTATTGTAAGCC
AATTAATACTACTTACAGTGACAATACTAAAATACAGCTGTGTATGAAAG
TGGACAATACACAAAACCATACACTACAACTAAAACAAAAACAAATCAGA
ATTGCAAGCTTTCTAGACCAT

BO27111.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 02:44:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 02:44:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10204928..10205164 17..253 1185 100 Plus
X 23542271 X 9557669..9557793 205..84 290 84 Minus
Blast to na_te.dros performed 2014-11-28 02:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5113..5232 138..257 113 58.2 Plus

BO27111.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:37 Download gff for BO27111.complete
Subject Subject Range Query Range Percent Splice Strand
CG32690-RA 426..662 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:23 Download gff for BO27111.complete
Subject Subject Range Query Range Percent Splice Strand
X 10204928..10205164 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:23 Download gff for BO27111.complete
Subject Subject Range Query Range Percent Splice Strand
X 10204928..10205164 17..255 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:48 Download gff for BO27111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10098961..10099197 17..255 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:48 Download gff for BO27111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10098961..10099197 17..255 99   Plus

BO27111.pep Sequence

Translation from 16 to 271

> BO27111.pep
MVTRIDTALIWIVEHSYIRYILHVFYCDLQLVLPVHTISFDYCKPINTTY
SDNTKIQLCMKVDNTQNHTLQLKQKQIRIASFLDH
Sequence BO27111.pep has no blast hits.