BO27116.complete Sequence
244 bp assembled on 2010-09-17
GenBank Submission: KX799807
> BO27116.complete
GAAGTTATCAGTCGACATGGTGCAGATCAAATTCCTTTTCGTCTTCCTGG
CTGTGATGACAATTGTTGTCCTGGCCGCCAATATGGCTGATGCCGATTGC
CTTTCCGGCAAATACAAGGGTCCCTGCGCCGTCTGGGACAACGAGATGTG
CCGACGTATTTGCAAGGAGGAGGGACATATCAGTGGCCACTGCAGTCCCA
GCCTGAAGTGCTGGTGCGAAGGATGCGCAAGCTTTCTAGACCAT
BO27116.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:51:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl2-RA | 213 | CG32279-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
| Drs-RA | 213 | CG10810-PA | 1..210 | 17..226 | 465 | 81.4 | Plus |
| Drsl5-RA | 210 | CG10812-PA | 2..207 | 21..226 | 445 | 81.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:51:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl2-RA | 333 | CG32279-RA | 17..236 | 7..226 | 1055 | 98.6 | Plus |
| Drs-RA | 387 | CG10810-RA | 64..273 | 17..226 | 465 | 81.4 | Plus |
| Drsl5-RA | 364 | CG10812-RA | 56..261 | 21..226 | 445 | 81.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:51:17
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3314365..3314584 | 7..226 | 1055 | 98.6 | Plus |
| 3L | 28110227 | 3L | 3369619..3369828 | 17..226 | 465 | 81.4 | Plus |
| 3L | 28110227 | 3L | 3316836..3317041 | 21..226 | 445 | 81.1 | Plus |
| 3L | 28110227 | 3L | 3336147..3336362 | 226..17 | 280 | 76.4 | Minus |
| 3L | 28110227 | 3L | 3335582..3335718 | 226..90 | 205 | 76.6 | Minus |
| 3L | 28110227 | 3L | 3315168..3315246 | 148..226 | 200 | 83.5 | Plus |
| 3L | 28110227 | 3L | 3315771..3315843 | 148..220 | 200 | 84.9 | Plus |
Blast to na_te.dros performed on 2014-11-28 05:51:18 has no hits.
BO27116.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:56 Download gff for
BO27116.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| dro2-RA | 27..236 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:24 Download gff for
BO27116.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl2-RA | 27..236 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:19:51 Download gff for
BO27116.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl2-RA | 27..236 | 17..228 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:19:51 Download gff for
BO27116.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3314375..3314584 | 17..228 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:24 Download gff for
BO27116.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3314375..3314584 | 17..228 | 99 | | Plus |
BO27116.pep Sequence
Translation from 16 to 244
> BO27116.pep
MVQIKFLFVFLAVMTIVVLAANMADADCLSGKYKGPCAVWDNEMCRRICK
EEGHISGHCSPSLKCWCEGCASFLDH
BO27116.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..70 | 394 | 100 | Plus |
| Drs-PA | 70 | CG10810-PA | 1..70 | 1..70 | 328 | 78.6 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 1..69 | 2..70 | 326 | 79.7 | Plus |
| Drsl6-PA | 72 | CG32268-PA | 1..72 | 1..70 | 299 | 69.4 | Plus |
| Drsl4-PA | 71 | CG32282-PA | 1..71 | 1..70 | 263 | 64.8 | Plus |
