Clone BO27117 Report

Search the DGRC for BO27117

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:17
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27117.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO27117.complete Sequence

265 bp assembled on 2010-09-17

> BO27117.complete
GAAGTTATCAGTCGACATGTGGAGTAGTACTATATCGCCAACCAACTCTA
AGAAACTGTTGATCGGAAGCACACGAAGCGTTGATTATGTCGGTGATAGT
GCGAGGACAGCAGCAGGCAATATCAAAACAGGAGCAGCAGCAGCCGCAGG
AGCCAAAGGATCAAAATCCAAAGCCACAGCCACAGCCCCCACAACCAAGA
TCTCAATCGAAATGGAGCTCCACATACAGAACAAGTGCATCTCGGCAGCA
AGCTTTCTAGACCAT

BO27117.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-RB 921 CG14669-PB 1..231 17..247 1155 100 Plus
CG14669-RD 234 CG14669-PD 1..231 17..247 1155 100 Plus
CG14669-RA 921 CG14669-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-RB 4442 CG14669-RB 744..974 17..247 1155 100 Plus
CG14669-RD 3648 CG14669-RD 744..974 17..247 1155 100 Plus
CG14669-RA 3648 CG14669-RA 744..974 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5437314..5437544 17..247 1155 100 Plus
Blast to na_te.dros performed 2014-11-28 05:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2324..2468 107..251 192 62.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6808..6942 107..250 148 61.1 Plus
roo 9092 roo DM_ROO 9092bp 1059..1150 109..197 127 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2606..2677 107..178 108 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6820..6900 107..184 108 65.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2443..2519 121..197 106 59.7 Plus

BO27117.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:55 Download gff for BO27117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 480..710 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:21 Download gff for BO27117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RC 744..974 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:19:50 Download gff for BO27117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 744..974 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:19:50 Download gff for BO27117.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5437314..5437544 17..249 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:21 Download gff for BO27117.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1263036..1263266 17..249 99   Plus

BO27117.pep Sequence

Translation from 16 to 265

> BO27117.pep
MWSSTISPTNSKKLLIGSTRSVDYVGDSARTAAGNIKTGAAAAAGAKGSK
SKATATAPTTKISIEMELHIQNKCISAASFLDH

BO27117.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-PD 77 CG14669-PD 1..77 1..77 379 100 Plus
CG14669-PC 192 CG14669-PC 1..77 1..77 379 100 Plus
CG14669-PB 306 CG14669-PB 1..77 1..77 379 100 Plus
CG14669-PA 306 CG14669-PA 1..77 1..77 379 100 Plus