BO27117.complete Sequence
265 bp assembled on 2010-09-17
> BO27117.complete
GAAGTTATCAGTCGACATGTGGAGTAGTACTATATCGCCAACCAACTCTA
AGAAACTGTTGATCGGAAGCACACGAAGCGTTGATTATGTCGGTGATAGT
GCGAGGACAGCAGCAGGCAATATCAAAACAGGAGCAGCAGCAGCCGCAGG
AGCCAAAGGATCAAAATCCAAAGCCACAGCCACAGCCCCCACAACCAAGA
TCTCAATCGAAATGGAGCTCCACATACAGAACAAGTGCATCTCGGCAGCA
AGCTTTCTAGACCAT
BO27117.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:51:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14669-RB | 921 | CG14669-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
CG14669-RD | 234 | CG14669-PD | 1..231 | 17..247 | 1155 | 100 | Plus |
CG14669-RA | 921 | CG14669-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:51:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14669-RB | 4442 | CG14669-RB | 744..974 | 17..247 | 1155 | 100 | Plus |
CG14669-RD | 3648 | CG14669-RD | 744..974 | 17..247 | 1155 | 100 | Plus |
CG14669-RA | 3648 | CG14669-RA | 744..974 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:51:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 5437314..5437544 | 17..247 | 1155 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 05:51:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2324..2468 | 107..251 | 192 | 62.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6808..6942 | 107..250 | 148 | 61.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1059..1150 | 109..197 | 127 | 65.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2606..2677 | 107..178 | 108 | 64.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6820..6900 | 107..184 | 108 | 65.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2443..2519 | 121..197 | 106 | 59.7 | Plus |
BO27117.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:55 Download gff for
BO27117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14669-RA | 480..710 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:21 Download gff for
BO27117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14669-RC | 744..974 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:19:50 Download gff for
BO27117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14669-RA | 744..974 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:19:50 Download gff for
BO27117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5437314..5437544 | 17..249 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:21 Download gff for
BO27117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 1263036..1263266 | 17..249 | 99 | | Plus |
BO27117.pep Sequence
Translation from 16 to 265
> BO27117.pep
MWSSTISPTNSKKLLIGSTRSVDYVGDSARTAAGNIKTGAAAAAGAKGSK
SKATATAPTTKISIEMELHIQNKCISAASFLDH
BO27117.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14669-PD | 77 | CG14669-PD | 1..77 | 1..77 | 379 | 100 | Plus |
CG14669-PC | 192 | CG14669-PC | 1..77 | 1..77 | 379 | 100 | Plus |
CG14669-PB | 306 | CG14669-PB | 1..77 | 1..77 | 379 | 100 | Plus |
CG14669-PA | 306 | CG14669-PA | 1..77 | 1..77 | 379 | 100 | Plus |