BO27121.complete Sequence
439 bp assembled on 2010-08-18
GenBank Submission: KX795205
> BO27121.complete
GAAGTTATCAGTCGACATGTGTAAATCGTGTGAGGAACAACCAGTTCGGT
GCTGCTCAATTTTCTATGCCGCTTTCTGCATTTCATGCGGTCTCTTCATG
CTCATTTTTTCGATTCACAATGTAATACTTTTGAAAAGCTCTATTACAGT
CGTGGATTTTTATTTGCATATGCATGGTGCTGACATGTCTCCCTCAACTT
TCCGCATCCTTTACTCGATGGATGTGATTTTTGCCCTTTCGTACGTCATT
GCTGGAACTTTACTAGCTGTTGGAATCCACCTGAACTCAAAGGGGGTCTT
CTTCGCTGGCAAGATCATAAGCTATTTCTTTCCAATATATAACATCCTTT
ATGTATTTCCTTTAATTGTGCACATTGCCGCCACAGTGAAATTATGCAGA
TATCTTAAAGAGAACTTTAATGCAAGCTTTCTAGACCAT
BO27121.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42393-RA | 408 | CG42393-PA | 1..405 | 17..421 | 2025 | 100 | Plus |
| CG32192-RC | 402 | CG32192-PC | 283..396 | 305..418 | 225 | 79.8 | Plus |
| CG32192-RB | 411 | CG32192-PB | 292..405 | 305..418 | 225 | 79.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42393-RA | 1142 | CG42393-RA | 112..516 | 17..421 | 2025 | 100 | Plus |
| CG32192-RC | 983 | CG32192-RC | 386..499 | 305..418 | 225 | 79.8 | Plus |
| CG32192-RB | 992 | CG32192-RB | 395..508 | 305..418 | 225 | 79.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 18042844..18043110 | 17..283 | 1335 | 100 | Plus |
| 3L | 28110227 | 3L | 18043185..18043267 | 283..365 | 415 | 100 | Plus |
| 3L | 28110227 | 3L | 18043326..18043386 | 361..421 | 290 | 98.4 | Plus |
| 3L | 28110227 | 3L | 18040784..18040843 | 305..364 | 195 | 88.3 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:43:55 has no hits.
BO27121.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:33 Download gff for
BO27121.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42393-RA | 112..516 | 17..423 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:38 Download gff for
BO27121.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42393-RA | 112..516 | 17..423 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:17 Download gff for
BO27121.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42393-RA | 112..516 | 17..423 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:17 Download gff for
BO27121.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 18042844..18043110 | 17..283 | 100 | -> | Plus |
| 3L | 18043186..18043267 | 284..365 | 100 | -> | Plus |
| 3L | 18043331..18043386 | 366..423 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:38 Download gff for
BO27121.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 18035944..18036210 | 17..283 | 100 | -> | Plus |
| arm_3L | 18036286..18036367 | 284..365 | 100 | -> | Plus |
| arm_3L | 18036431..18036486 | 366..423 | 96 | | Plus |
BO27121.pep Sequence
Translation from 16 to 439
> BO27121.pep
MCKSCEEQPVRCCSIFYAAFCISCGLFMLIFSIHNVILLKSSITVVDFYL
HMHGADMSPSTFRILYSMDVIFALSYVIAGTLLAVGIHLNSKGVFFAGKI
ISYFFPIYNILYVFPLIVHIAATVKLCRYLKENFNASFLDH
BO27121.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:24:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42393-PA | 135 | CG42393-PA | 1..135 | 1..135 | 707 | 100 | Plus |
| CG32192-PB | 136 | CG32192-PB | 3..136 | 2..135 | 472 | 61.2 | Plus |
| CG32192-PC | 133 | CG32192-PC | 3..133 | 2..135 | 455 | 60.4 | Plus |
| CG44163-PA | 118 | CG44163-PA | 8..117 | 12..134 | 174 | 36.6 | Plus |
