BO27137.complete Sequence
421 bp assembled on 2010-08-18
GenBank Submission: KX795481
> BO27137.complete
GAAGTTATCAGTCGACATGGACAGCAAGCAGCCTCCACCGTACAGTGAAC
AGTCCGGATACACTCCCGCACAAACCTATCAGCCCGGTGGCCCCACCCAG
CCACCACTGTACCCACCGATGCCGCAGCCACCGCAGTCCTCAACGGTGAT
CATCCAGACCACCACAACCTCCAACCTGGTGCCCATCGGCAGTGGACCCA
CCCGCATCCGCTGTCCCTCCTGTCACGCCGAAGTACTGACCACCGTGAAG
TCCACTCCTTCCGGCAGGACGCACTGCTGGGCCCTCATCCTGTGCCTGTT
CATCTGCTGGCCGTGCGTATGCCTACCTTACTGCATGGACTCCTGCCAGA
ATGCCAACCACTACTGCCCCAACTGCAGCGCCTACATCGGCACCTACGAG
AACGCAAGCTTTCTAGACCAT
BO27137.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13510-RC | 390 | CG13510-PC | 1..387 | 17..403 | 1935 | 100 | Plus |
CG13510-RB | 390 | CG13510-PB | 1..387 | 17..403 | 1935 | 100 | Plus |
CG13510-RA | 390 | CG13510-PA | 1..387 | 17..403 | 1935 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42565-RB | 2577 | CG42565-RB | 89..475 | 17..403 | 1935 | 100 | Plus |
CG13511-RB | 2577 | CG13511-RB | 89..475 | 17..403 | 1935 | 100 | Plus |
CG13510-RC | 2577 | CG13510-RC | 89..475 | 17..403 | 1935 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22657989..22658275 | 17..303 | 1435 | 100 | Plus |
2R | 25286936 | 2R | 22658923..22659022 | 304..403 | 500 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:43:38 has no hits.
BO27137.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:28 Download gff for
BO27137.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13510-RA | 85..471 | 17..405 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:33 Download gff for
BO27137.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13510-RA | 89..475 | 17..405 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:12 Download gff for
BO27137.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13510-RC | 89..475 | 17..405 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:12 Download gff for
BO27137.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22657989..22658275 | 17..303 | 100 | -> | Plus |
2R | 22658923..22659022 | 304..405 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:33 Download gff for
BO27137.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18546428..18546527 | 304..405 | 98 | | Plus |
arm_2R | 18545494..18545780 | 17..303 | 100 | -> | Plus |
BO27137.pep Sequence
Translation from 16 to 421
> BO27137.pep
MDSKQPPPYSEQSGYTPAQTYQPGGPTQPPLYPPMPQPPQSSTVIIQTTT
TSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPC
VCLPYCMDSCQNANHYCPNCSAYIGTYENASFLDH
BO27137.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:24:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13510-PC | 129 | CG13510-PC | 1..129 | 1..129 | 745 | 100 | Plus |
CG13510-PB | 129 | CG13510-PB | 1..129 | 1..129 | 745 | 100 | Plus |
CG13510-PA | 129 | CG13510-PA | 1..129 | 1..129 | 745 | 100 | Plus |
CG30273-PB | 128 | CG30273-PB | 16..127 | 4..129 | 263 | 41.3 | Plus |
CG30269-PB | 144 | CG30269-PB | 33..142 | 7..128 | 254 | 41.8 | Plus |