BO27149.complete Sequence
370 bp assembled on 2010-08-18
GenBank Submission: KX795032
> BO27149.complete
GAAGTTATCAGTCGACATGCGTCTTCTGCTCATCCTCTCAGTTGTCCTGG
CCGTGATCCTCGGCTGCCACGCCTACAGCGCCACCTGGGGGCGCAGGGTC
AACAACGATTTCCTCCTCTCACGCACCAGGGAAGTTCGCAATCCGATCAA
GAACAACTACTGGAACGTGAACGTGAACTACCCCAATGGATTCTACAACA
TCTCCGCCGTGATCGTGTACGACAACTTCAAGAACAACTCTGGAGCATCT
CCTAGCCTCTATTCCGGCGGTCCGGGCTACCGCTTTGCCACCGTGAATCT
TCGTGGTCAGGTGAACCGCGGAATCGACTCCACCGTCGAGATCTGGGGTC
GTGCAAGCTTTCTAGACCAT
BO27149.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13324-RA | 339 | CG13324-PA | 1..336 | 17..352 | 1680 | 100 | Plus |
CG13323-RB | 339 | CG13323-PB | 1..336 | 17..352 | 1290 | 92.3 | Plus |
CG13323-RA | 339 | CG13323-PA | 1..336 | 17..352 | 1290 | 92.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13324-RA | 511 | CG13324-RA | 37..374 | 15..352 | 1690 | 100 | Plus |
CG13323-RB | 2562 | CG13323-RB | 39..376 | 15..352 | 1300 | 92.3 | Plus |
CG13323-RA | 521 | CG13323-RA | 39..376 | 15..352 | 1300 | 92.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13049283..13049620 | 352..15 | 1690 | 100 | Minus |
2R | 25286936 | 2R | 13046881..13047218 | 352..15 | 1300 | 92.3 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:43:27 has no hits.
BO27149.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:22 Download gff for
BO27149.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13324-RA | 1..336 | 17..354 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:30 Download gff for
BO27149.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13324-RA | 20..355 | 17..354 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:10 Download gff for
BO27149.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13324-RA | 39..374 | 17..354 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:10 Download gff for
BO27149.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13049281..13049618 | 17..354 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:30 Download gff for
BO27149.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8936786..8937123 | 17..354 | 99 | | Minus |
BO27149.pep Sequence
Translation from 16 to 370
> BO27149.pep
MRLLLILSVVLAVILGCHAYSATWGRRVNNDFLLSRTREVRNPIKNNYWN
VNVNYPNGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVN
RGIDSTVEIWGRASFLDH
BO27149.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13324-PA | 112 | CG13324-PA | 1..112 | 1..112 | 595 | 100 | Plus |
CG13323-PB | 112 | CG13323-PB | 1..112 | 1..112 | 562 | 94.6 | Plus |
CG13323-PA | 112 | CG13323-PA | 1..112 | 1..112 | 562 | 94.6 | Plus |
CG31789-PC | 117 | CG31789-PC | 4..114 | 1..110 | 141 | 28.9 | Plus |
CG31789-PB | 117 | CG31789-PB | 4..114 | 1..110 | 141 | 28.9 | Plus |