Clone BO27150 Report

Search the DGRC for BO27150

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG14245-RA
Protein status:BO27150.pep: Inserted from web
Sequenced Size:343

Clone Sequence Records

BO27150.complete Sequence

343 bp assembled on 2010-08-18

GenBank Submission: KX799858

> BO27150.complete
GAAGTTATCAGTCGACATGAAGTTCCTGCCTCTGTTCGCCTTTTTCCTAA
TCCTCGGCTACTCCTCCTTCTGCAGCGGAGCTGCTGTGGCCAAGCCCACT
GGTCAACCCGGTTGCCAAACGGCCGAGGAGCTGGAGGTGGCATTCTATGC
CCACTTCTACCTGAAGAGCTCCTACTGGGTGTGCTCCACCCAGGGCGTTC
CCGCCACCCTCGCCCAGTGCCCCATTGCCTCCGCCTGGTTGGACTCCGCC
AAGGCCTGTGTTCCCTGGCCCCAGTGGGTGTGGTCGCCCACTGTCCAGCC
GCCCAGCCAACCCGAAGTTGCTGCAGCAAGCTTTCTAGACCAT

BO27150.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14245-RB 312 CG14245-PB 1..309 17..325 1545 100 Plus
CG14245-RA 312 CG14245-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14245-RB 615 CG14245-RB 35..343 17..325 1545 100 Plus
CG14245-RA 393 CG14245-RA 35..343 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26728761..26729069 17..325 1545 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:39 has no hits.

BO27150.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:09 Download gff for BO27150.complete
Subject Subject Range Query Range Percent Splice Strand
CG14246-RA 219..527 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:39 Download gff for BO27150.complete
Subject Subject Range Query Range Percent Splice Strand
CG14245-RA 35..343 17..327 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:09 Download gff for BO27150.complete
Subject Subject Range Query Range Percent Splice Strand
CG14245-RA 35..343 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:09 Download gff for BO27150.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26728761..26729069 17..327 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:39 Download gff for BO27150.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22554483..22554791 17..327 99   Plus

BO27150.pep Sequence

Translation from 16 to 343

> BO27150.pep
MKFLPLFAFFLILGYSSFCSGAAVAKPTGQPGCQTAEELEVAFYAHFYLK
SSYWVCSTQGVPATLAQCPIASAWLDSAKACVPWPQWVWSPTVQPPSQPE
VAAASFLDH

BO27150.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14245-PB 103 CG14245-PB 1..103 1..103 568 100 Plus
CG14245-PA 103 CG14245-PA 1..103 1..103 568 100 Plus
CG14645-PA 97 CG14645-PA 25..96 29..100 172 38.9 Plus
CG14300-PA 94 CG14300-PA 18..92 22..97 156 34.2 Plus
CG14246-PC 93 CG14246-PC 8..91 29..99 147 32.9 Plus