BO27187.complete Sequence
343 bp assembled on 2010-08-18
GenBank Submission: KX799396
> BO27187.complete
GAAGTTATCAGTCGACATGTCTGCCCTGCGCCGTGATGTGTCGCCTTTAA
TCCAGCGCATTCGGGCCTTCCTCCTGGGTCGGGAGCACAACCTGGCCCTG
CGCTTCGAGGACGGACTGGCCGATCGCACCCAGCCACAGCCGGAAATCCC
TGACGGTCCATCGCATCTACTCTCGGCCAACTACTACTGCCAGCGGGATG
GACGTCGCGAGGTTCTGCCGCCCATCGACCTGGTGGAGCAGCAGAAGCAG
CTGGCGGCAGAGGGGGAAGCGGCGAAGGCCCCGTCTTCCAAGCTGCCCAC
TCCCGGCAAGGTCTATGCCTGGGATGCAAGCTTTCTAGACCAT
BO27187.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3621-RB | 312 | CG3621-PB | 1..309 | 17..325 | 1545 | 100 | Plus |
CG3621-RA | 312 | CG3621-PA | 1..309 | 17..325 | 1545 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3621-RB | 807 | CG3621-RB | 118..426 | 17..325 | 1545 | 100 | Plus |
CG3621-RA | 512 | CG3621-RA | 118..426 | 17..325 | 1545 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2172806..2173051 | 80..325 | 1230 | 100 | Plus |
X | 23542271 | X | 2172643..2172705 | 17..79 | 315 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:41:34 has no hits.
BO27187.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:55 Download gff for
BO27187.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3621-RA | 117..425 | 17..327 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:51 Download gff for
BO27187.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3621-RA | 118..426 | 17..327 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:31 Download gff for
BO27187.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3621-RA | 118..426 | 17..327 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:31 Download gff for
BO27187.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2172643..2172705 | 17..79 | 100 | -> | Plus |
X | 2172806..2173051 | 80..327 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:51 Download gff for
BO27187.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2066676..2066738 | 17..79 | 100 | -> | Plus |
arm_X | 2066839..2067084 | 80..327 | 99 | | Plus |
BO27187.pep Sequence
Translation from 16 to 343
> BO27187.pep
MSALRRDVSPLIQRIRAFLLGREHNLALRFEDGLADRTQPQPEIPDGPSH
LLSANYYCQRDGRREVLPPIDLVEQQKQLAAEGEAAKAPSSKLPTPGKVY
AWDASFLDH
BO27187.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3621-PB | 103 | CG3621-PB | 1..103 | 1..103 | 536 | 100 | Plus |
CG3621-PA | 103 | CG3621-PA | 1..103 | 1..103 | 536 | 100 | Plus |
CG6914-PA | 145 | CG6914-PA | 8..142 | 6..103 | 215 | 40 | Plus |