Clone BO27187 Report

Search the DGRC for BO27187

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG3621-RA
Protein status:BO27187.pep: Imported from assembly
Sequenced Size:343

Clone Sequence Records

BO27187.complete Sequence

343 bp assembled on 2010-08-18

GenBank Submission: KX799396

> BO27187.complete
GAAGTTATCAGTCGACATGTCTGCCCTGCGCCGTGATGTGTCGCCTTTAA
TCCAGCGCATTCGGGCCTTCCTCCTGGGTCGGGAGCACAACCTGGCCCTG
CGCTTCGAGGACGGACTGGCCGATCGCACCCAGCCACAGCCGGAAATCCC
TGACGGTCCATCGCATCTACTCTCGGCCAACTACTACTGCCAGCGGGATG
GACGTCGCGAGGTTCTGCCGCCCATCGACCTGGTGGAGCAGCAGAAGCAG
CTGGCGGCAGAGGGGGAAGCGGCGAAGGCCCCGTCTTCCAAGCTGCCCAC
TCCCGGCAAGGTCTATGCCTGGGATGCAAGCTTTCTAGACCAT

BO27187.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG3621-RB 312 CG3621-PB 1..309 17..325 1545 100 Plus
CG3621-RA 312 CG3621-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3621-RB 807 CG3621-RB 118..426 17..325 1545 100 Plus
CG3621-RA 512 CG3621-RA 118..426 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2172806..2173051 80..325 1230 100 Plus
X 23542271 X 2172643..2172705 17..79 315 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:41:34 has no hits.

BO27187.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:55 Download gff for BO27187.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 117..425 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:51 Download gff for BO27187.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 118..426 17..327 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:31 Download gff for BO27187.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 118..426 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:31 Download gff for BO27187.complete
Subject Subject Range Query Range Percent Splice Strand
X 2172643..2172705 17..79 100 -> Plus
X 2172806..2173051 80..327 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:51 Download gff for BO27187.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2066676..2066738 17..79 100 -> Plus
arm_X 2066839..2067084 80..327 99   Plus

BO27187.pep Sequence

Translation from 16 to 343

> BO27187.pep
MSALRRDVSPLIQRIRAFLLGREHNLALRFEDGLADRTQPQPEIPDGPSH
LLSANYYCQRDGRREVLPPIDLVEQQKQLAAEGEAAKAPSSKLPTPGKVY
AWDASFLDH

BO27187.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3621-PB 103 CG3621-PB 1..103 1..103 536 100 Plus
CG3621-PA 103 CG3621-PA 1..103 1..103 536 100 Plus
CG6914-PA 145 CG6914-PA 8..142 6..103 215 40 Plus