Clone BO27206 Report

Search the DGRC for BO27206

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptRpLP2-RA
Protein status:BO27206.pep: Imported from assembly
Sequenced Size:373

Clone Sequence Records

BO27206.complete Sequence

373 bp assembled on 2010-08-18

GenBank Submission: KX796376

> BO27206.complete
GAAGTTATCAGTCGACATGCGTTACGTGGCTGCTTACCTTCTGGCCGTCC
TCGGTGGCAAGGACTCGCCCGCCAACAGCGATCTGGAGAAGATCCTCAGC
TCTGTGGGCGTTGAGGTCGACGCCGAGCGTCTGACCAAGGTCATCAAGGA
GCTGGCTGGCAAGAGCATCGACGACCTGATCAAGGAGGGTCGCGAGAAGC
TCTCCTCGATGCCGGTGGGCGGCGGTGGTGCCGTCGCAGCCGCTGATGCC
GCACCCGCTGCCGCCGCCGGTGGCGACAAGAAGGAGGCCAAGAAGGAGGA
GAAGAAGGAGGAGTCCGAGTCCGAGGATGACGACATGGGCTTCGCTCTCT
TCGAAGCAAGCTTTCTAGACCAT

BO27206.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-RA 342 CG4918-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-RA 604 CG4918-RA 93..433 15..355 1705 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16586221..16586561 15..355 1705 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:44:33 has no hits.

BO27206.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:41 Download gff for BO27206.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RB 130..468 17..357 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:53 Download gff for BO27206.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 95..433 17..357 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:27 Download gff for BO27206.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP2-RA 95..433 17..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:27 Download gff for BO27206.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16586223..16586561 17..357 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:53 Download gff for BO27206.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12473728..12474066 17..357 99   Plus

BO27206.pep Sequence

Translation from 16 to 373

> BO27206.pep
MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKS
IDDLIKEGREKLSSMPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEES
ESEDDDMGFALFEASFLDH

BO27206.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP2-PA 113 CG4918-PA 1..113 1..113 551 100 Plus
RpLP1-PB 112 CG4087-PB 28..112 23..113 146 43.6 Plus
RpLP1-PA 112 CG4087-PA 28..112 23..113 146 43.6 Plus