Clone BO27207 Report

Search the DGRC for BO27207

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG31789-RA
Protein status:BO27207.pep: Imported from assembly
Sequenced Size:385

Clone Sequence Records

BO27207.complete Sequence

385 bp assembled on 2010-08-18

GenBank Submission: KX797089

> BO27207.complete
GAAGTTATCAGTCGACATGAAGGCCTTGCAATTCGCTCTTGTATTTTCGG
CCATTCTGGCCATTGCCTTCGCTGCAAATGCCAGTTGGGGAGCCAAATTG
TCCAGCAGTAAGTTGGTCAGCACTCAGAACGTGACCATCTACAAGAAGGC
CAACCAATATGTGAGCAGTCTCATCAGTTTCCCACTGGCGGGCCAGAGCA
ACACTAAAACCATTCGGTACATTAGCATAACTGATAGGTTTACCAACAGT
TCGGGACCTTACTCCACCTTGTGGTCCGGTGGACCAGGATTCATCAATGC
CCAGGTCAATGTCACAAGCCAGTTTTCTCAAGGAATCAATGTAACTGCTC
AATTTTGGGTGGATGCCGCAAGCTTTCTAGACCAT

BO27207.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-RC 354 CG31789-PC 1..351 17..367 1755 100 Plus
CG31789-RB 354 CG31789-PB 1..351 17..367 1755 100 Plus
CG31789-RA 354 CG31789-PA 1..351 17..367 1755 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-RC 695 CG31789-RC 15..365 17..367 1755 100 Plus
CG31789-RB 472 CG31789-RB 15..365 17..367 1755 100 Plus
CG31789-RA 534 CG31789-RA 15..365 17..367 1755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18606177..18606354 190..367 890 100 Plus
2L 23513712 2L 18605942..18606116 17..191 875 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:44:27 has no hits.

BO27207.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:40 Download gff for BO27207.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 1..351 17..369 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:51 Download gff for BO27207.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 15..365 17..369 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:26 Download gff for BO27207.complete
Subject Subject Range Query Range Percent Splice Strand
CG31789-RA 15..365 17..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:26 Download gff for BO27207.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18605942..18606115 17..190 100 -> Plus
2L 18606178..18606354 191..369 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:51 Download gff for BO27207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18605942..18606115 17..190 100 -> Plus
arm_2L 18606178..18606354 191..369 98   Plus

BO27207.pep Sequence

Translation from 16 to 385

> BO27207.pep
MKALQFALVFSAILAIAFAANASWGAKLSSSKLVSTQNVTIYKKANQYVS
SLISFPLAGQSNTKTIRYISITDRFTNSSGPYSTLWSGGPGFINAQVNVT
SQFSQGINVTAQFWVDAASFLDH

BO27207.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31789-PC 117 CG31789-PC 1..117 1..117 586 100 Plus
CG31789-PB 117 CG31789-PB 1..117 1..117 586 100 Plus
CG31789-PA 117 CG31789-PA 1..117 1..117 586 100 Plus
CG13323-PB 112 CG13323-PB 1..110 4..114 145 32.5 Plus
CG13323-PA 112 CG13323-PA 1..110 4..114 145 32.5 Plus