Clone BO27240 Report

Search the DGRC for BO27240

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:40
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27240.pep: Imported from assembly
Sequenced Size:241

Clone Sequence Records

BO27240.complete Sequence

241 bp assembled on 2010-09-22

> BO27240.complete
GAAGTTATCAGTCGACATGCTTAGGCACAAACGCAACTGCCACGCCATTC
AGACGCCCAGCGACGCCGAGCATGTGAAGTTAAAGCCGCATTTTCATCCG
CCCCAGTGGCTCCTGCACCGCGTCACCTTCTCTTTGGAGCTGTATCACAA
GAATATCATCAAGAAACTGCCCAGTCTTGGCCAATTTCACGTTTACCGGC
TGACCAAGAACGTCTGCCAGACTGCAAGCTTTCTAGACCAT

BO27240.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 07:54:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Glut4EF-RH 10796 CG34360-RH 461..667 17..223 1035 100 Plus
Glut4EF-RG 4308 CG34360-RG 461..667 17..223 1035 100 Plus
Glut4EF-RC 3418 CG34360-RC 461..667 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9875141..9875347 17..223 1035 100 Plus
Blast to na_te.dros performed on 2014-11-28 07:54:24 has no hits.

BO27240.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-22 14:38:27 Download gff for BO27240.complete
Subject Subject Range Query Range Percent Splice Strand
CG34360-RA 461..667 17..225 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:54 Download gff for BO27240.complete
Subject Subject Range Query Range Percent Splice Strand
Glut4EF-RC 461..667 17..225 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:06:34 Download gff for BO27240.complete
Subject Subject Range Query Range Percent Splice Strand
Glut4EF-RC 461..667 17..225 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:06:34 Download gff for BO27240.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9875141..9875347 17..225 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:54 Download gff for BO27240.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5700863..5701069 17..225 99   Plus

BO27240.pep Sequence

Translation from 16 to 241

> BO27240.pep
MLRHKRNCHAIQTPSDAEHVKLKPHFHPPQWLLHRVTFSLELYHKNIIKK
LPSLGQFHVYRLTKNVCQTASFLDH
Sequence BO27240.pep has no blast hits.