Clone BO27246 Report

Search the DGRC for BO27246

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:272
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG13227-RA
Protein status:BO27246.pep: Imported from assembly
Sequenced Size:394

Clone Sequence Records

BO27246.complete Sequence

394 bp assembled on 2010-09-22

GenBank Submission: KX799670

> BO27246.complete
GAAGTTATCAGTCGACATGGATCACAAGTGGATAATATTTTTCTTCAGCA
TTGCTGCTCTGCTCTTATGCAATTTTGTTAGAGCCGATGAAACGGAAACG
GAAGTGGTGCAGGAGAAACCAAGCTCTATTCAGCTGCTGGACGCCGGAGA
AACGGCCCAGTCTGATTCCACAGACGAGAACGTTAGGAAAGTGCGCCAGT
ACTTTGGACCACCACCGTTTGGACCACCGCCACCACCCTTCTTTGGACCA
CCTCCACCACCGTACTACGGCGGCGGCTTTGGTGGCGGATTCGGCGGTGG
TTTCCAGAGAACTCGAGTGGTCACCCGCACCCGTTACCGCGGACGCGGTG
GTTACTATGGCGGTGGATTCTACGGCGCAAGCTTTCTAGACCAT

BO27246.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-RA 363 CG13227-PA 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-RA 504 CG13227-RA 34..398 12..376 1810 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11235285..11235649 12..376 1810 99.7 Plus
Blast to na_te.dros performed on 2014-11-28 07:54:56 has no hits.

BO27246.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-22 14:38:28 Download gff for BO27246.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 37..396 17..378 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:57 Download gff for BO27246.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 39..398 17..378 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:06:48 Download gff for BO27246.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 39..398 17..378 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:06:48 Download gff for BO27246.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235290..11235649 17..378 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:57 Download gff for BO27246.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7122795..7123154 17..378 99   Plus

BO27246.pep Sequence

Translation from 16 to 394

> BO27246.pep
MDHKWIIFFFSIAALLLCNFVRADETETEVVQEKPSSIQLLDAGETAQSD
STDENVRKVRQYFGPPPFGPPPPPFFGPPPPPYYGGGFGGGFGGGFQRTR
VVTRTRYRGRGGYYGGGFYGASFLDH

BO27246.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-PA 120 CG13227-PA 1..120 1..120 668 100 Plus