Clone BO27325 Report

Search the DGRC for BO27325

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG42448-RA
Protein status:BO27325.pep: Imported from assembly
Sequenced Size:433

Clone Sequence Records

BO27325.complete Sequence

433 bp assembled on 2010-08-18

GenBank Submission: KX799002

> BO27325.complete
GAAGTTATCAGTCGACATGGAATCAGCCGTACGAAAGCGCAGAGTTCCCT
TTCTCCAGGACAATAGACATTCCGATAAACGGACATGCAACTTGTCAACA
ATATCACCTCGCAGCACTCTAGTTCAAACAGTAAAGAAACCCGTCAAGAA
GTTCTCTTCGGATTTAGCCAATCTTCCACCGGTTCCCGCAATCGATGCTT
TTGAGCGAGGCTACCAAGTGGAATCGATATTGGACATGGTACAAAACATC
CACAAGGAGCAATTCCTCTACATAAAGTTTACGAATCTCATTGAACCCGA
GTTGGTTCCTTTGGAACTGGCCTTACAGCATGTTCCACACCTGCTTTCTG
ATTTCTACAAGGAATACGTCCAGGCCTGGCAGAAAATGGAACAACAGAAG
TATGATGAATCTCCTGCAAGCTTTCTAGACCAT

BO27325.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-RA 402 CG42448-PA 1..399 17..415 1995 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-RA 670 CG42448-RA 47..445 17..415 1995 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15547668..15548018 65..415 1755 100 Plus
2L 23513712 2L 15547565..15547612 17..64 240 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:55:54 has no hits.

BO27325.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:55 Download gff for BO27325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42448-RA 1..399 17..417 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:59 Download gff for BO27325.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 47..445 17..417 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:53 Download gff for BO27325.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 47..445 17..417 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:53 Download gff for BO27325.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15547565..15547612 17..64 100 -> Plus
2L 15547668..15548018 65..417 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:59 Download gff for BO27325.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15547565..15547612 17..64 100 -> Plus
arm_2L 15547668..15548018 65..417 99   Plus

BO27325.pep Sequence

Translation from 16 to 433

> BO27325.pep
MESAVRKRRVPFLQDNRHSDKRTCNLSTISPRSTLVQTVKKPVKKFSSDL
ANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLE
LALQHVPHLLSDFYKEYVQAWQKMEQQKYDESPASFLDH

BO27325.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-PA 133 CG42448-PA 1..133 1..133 689 100 Plus