BO27326.complete Sequence
265 bp assembled on 2010-08-18
GenBank Submission: KX796517
> BO27326.complete
GAAGTTATCAGTCGACATGTGCAAGTGTCTGGTCGGAAACGTTGCCTGCT
GCTGCTGCAGTTGTGCAATTAGTGTGCTTGTTTCAATCATCAGTGGATTG
CTGGTGGTCGGCATTGTGGTCGGATTGGCCGTCTACTTTCTTGTCTACTA
CGAACCGGAGGATGAGGTTACCAAGTTCACCAATAAATTAGCCGAAAGTG
TACAGTCGGGATATGGCAAAATTAAGGATGTCATAAGCAAATTAAATGCA
AGCTTTCTAGACCAT
BO27326.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:32:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42394-RC | 234 | CG42394-PC | 1..231 | 17..247 | 1155 | 100 | Plus |
| CG42394-RB | 234 | CG42394-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
| CG42394-RD | 234 | CG42394-PD | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42394-RC | 634 | CG42394-RC | 94..326 | 15..247 | 1165 | 100 | Plus |
| CG42394-RB | 503 | CG42394-RB | 23..255 | 15..247 | 1165 | 100 | Plus |
| CG42394-RD | 582 | CG42394-RD | 94..326 | 15..247 | 1165 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:32:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 10851284..10851480 | 51..247 | 985 | 100 | Plus |
| 3R | 32079331 | 3R | 10849983..10850019 | 15..51 | 185 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 02:32:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 825..900 | 83..11 | 103 | 61.8 | Minus |
BO27326.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:57 Download gff for
BO27326.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42394-RA | 19..249 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:37 Download gff for
BO27326.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42394-RA | 25..255 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:45 Download gff for
BO27326.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42394-RD | 96..326 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:45 Download gff for
BO27326.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 10849985..10850019 | 17..51 | 100 | -> | Plus |
| 3R | 10851285..10851480 | 52..249 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:37 Download gff for
BO27326.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 6677007..6677202 | 52..249 | 98 | | Plus |
| arm_3R | 6675707..6675741 | 17..51 | 100 | -> | Plus |
BO27326.pep Sequence
Translation from 16 to 265
> BO27326.pep
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLNASFLDH
BO27326.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:04:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42394-PC | 77 | CG42394-PC | 1..77 | 1..77 | 398 | 100 | Plus |
| CG42394-PB | 77 | CG42394-PB | 1..77 | 1..77 | 398 | 100 | Plus |
| CG42394-PD | 77 | CG42394-PD | 1..77 | 1..77 | 398 | 100 | Plus |
| CG42394-PA | 77 | CG42394-PA | 1..77 | 1..77 | 398 | 100 | Plus |
| mex1-PC | 83 | CG7936-PC | 5..81 | 1..75 | 149 | 36.4 | Plus |
