Clone BO27332 Report

Search the DGRC for BO27332

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A1-RA
Protein status:BO27332.pep: Imported from assembly
Sequenced Size:313

Clone Sequence Records

BO27332.complete Sequence

313 bp assembled on 2010-08-18

GenBank Submission: KX793912

> BO27332.complete
GAAGTTATCAGTCGACATGAAGTTCTTCATTTTGATTTCATTCTTACTGG
TCTGTCAAGGGTCCAACGAAGAGGAGGATAACATAATAGCCGAGTTGTGC
TTCAATCCGAATTCTGGACCTCCTTGCCAGAAATTAAAAACATATTATTG
GGATAAGGAAAAGAATCGATGCGTGCTCTCTCGGTATTTAATGCAGCCTT
GTGGTTTCTTTGACACAATAGACATGTGCGATAAAATATGCACCAAGGAA
TCGTGGACAATATCTCATTTGGAAGTATATGTTCGAAATATGCCTGCAAG
CTTTCTAGACCAT

BO27332.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A1-RA 282 CG42472-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A1-RA 359 CG42472-RA 20..302 13..295 1400 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11754142..11754345 295..92 1020 100 Minus
2L 23513712 2L 11754404..11754483 92..13 385 98.8 Minus
Blast to na_te.dros performed on 2014-11-28 02:33:25 has no hits.

BO27332.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:03 Download gff for BO27332.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A1-RA 24..302 17..297 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:50 Download gff for BO27332.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A1-RA 24..302 17..297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:53 Download gff for BO27332.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A1-RA 24..302 17..297 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:53 Download gff for BO27332.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11754140..11754344 93..297 99 <- Minus
2L 11754404..11754479 17..92 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:50 Download gff for BO27332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11754404..11754479 17..92 100   Minus
arm_2L 11754140..11754344 93..297 99 <- Minus

BO27332.pep Sequence

Translation from 16 to 313

> BO27332.pep
MKFFILISFLLVCQGSNEEEDNIIAELCFNPNSGPPCQKLKTYYWDKEKN
RCVLSRYLMQPCGFFDTIDMCDKICTKESWTISHLEVYVRNMPASFLDH

BO27332.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A1-PA 93 CG42472-PA 1..93 1..93 520 100 Plus