Clone BO27333 Report

Search the DGRC for BO27333

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptSfp24C1-RA
Protein status:BO27333.pep: Imported from assembly
Sequenced Size:274

Clone Sequence Records

BO27333.complete Sequence

274 bp assembled on 2010-08-18

GenBank Submission: KX796257

> BO27333.complete
GAAGTTATCAGTCGACATGAGGTCGTTTTGTATATTGGCCTTATTAATAA
CCCTTAAGTTCGAAATGGGATATGGAAATTCTGTCTGCAATCTTCAGGCC
ACATTCATTGGATGGTGTAAAATGACTATAAGAGGATTTACTTTCGTAGC
TTCCAAAAACGCATGCCGTAGAATTTCTGGACCATGTGCTGCACAGGATA
ACTTTTTCATGGACAAAGCTTCCTGCGAAACAGCATGCAAAAAAATAATA
TTACCTGCAAGCTTTCTAGACCAT

BO27333.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-RA 243 CG42466-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-RA 363 CG42466-RA 27..266 17..256 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700820..3700995 81..256 880 100 Plus
2L 23513712 2L 3700700..3700763 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:33:30 has no hits.

BO27333.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:04 Download gff for BO27333.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 27..266 17..258 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:52 Download gff for BO27333.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 27..266 17..258 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:55 Download gff for BO27333.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 27..266 17..258 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:55 Download gff for BO27333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700700..3700763 17..80 100 -> Plus
2L 3700820..3700995 81..258 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:52 Download gff for BO27333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3700700..3700763 17..80 100 -> Plus
arm_2L 3700820..3700995 81..258 98   Plus

BO27333.pep Sequence

Translation from 16 to 274

> BO27333.pep
MRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKNAC
RRISGPCAAQDNFFMDKASCETACKKIILPASFLDH

BO27333.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-PA 80 CG42466-PA 1..80 1..80 430 100 Plus
CG42467-PA 82 CG42467-PA 1..81 1..78 143 40.7 Plus