BO27333.complete Sequence
274 bp assembled on 2010-08-18
GenBank Submission: KX796257
> BO27333.complete
GAAGTTATCAGTCGACATGAGGTCGTTTTGTATATTGGCCTTATTAATAA
CCCTTAAGTTCGAAATGGGATATGGAAATTCTGTCTGCAATCTTCAGGCC
ACATTCATTGGATGGTGTAAAATGACTATAAGAGGATTTACTTTCGTAGC
TTCCAAAAACGCATGCCGTAGAATTTCTGGACCATGTGCTGCACAGGATA
ACTTTTTCATGGACAAAGCTTCCTGCGAAACAGCATGCAAAAAAATAATA
TTACCTGCAAGCTTTCTAGACCAT
BO27333.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:33:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-RA | 243 | CG42466-PA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-RA | 363 | CG42466-RA | 27..266 | 17..256 | 1200 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700820..3700995 | 81..256 | 880 | 100 | Plus |
2L | 23513712 | 2L | 3700700..3700763 | 17..80 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:33:30 has no hits.
BO27333.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:04 Download gff for
BO27333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 27..266 | 17..258 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:52 Download gff for
BO27333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 27..266 | 17..258 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:55 Download gff for
BO27333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 27..266 | 17..258 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:55 Download gff for
BO27333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700700..3700763 | 17..80 | 100 | -> | Plus |
2L | 3700820..3700995 | 81..258 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:52 Download gff for
BO27333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3700700..3700763 | 17..80 | 100 | -> | Plus |
arm_2L | 3700820..3700995 | 81..258 | 98 | | Plus |
BO27333.pep Sequence
Translation from 16 to 274
> BO27333.pep
MRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKNAC
RRISGPCAAQDNFFMDKASCETACKKIILPASFLDH
BO27333.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:05:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-PA | 80 | CG42466-PA | 1..80 | 1..80 | 430 | 100 | Plus |
CG42467-PA | 82 | CG42467-PA | 1..81 | 1..78 | 143 | 40.7 | Plus |