Clone BO27334 Report

Search the DGRC for BO27334

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptSfp24Bb-RA
Protein status:BO27334.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO27334.complete Sequence

364 bp assembled on 2010-08-18

GenBank Submission: KX794765

> BO27334.complete
GAAGTTATCAGTCGACATGAAATTCGTGATATTGCTATCCTTGATGTGCA
TCGGAATTGGTTATGCCCAACAACAGTCGGAAGTCAAATGCTTCATGGAC
GCCATTCCTGTGGGCGAATGTGGTAGTCGGATTATAGGGTATAGCTATTC
GAGTGTAAGAGCCCGTTGCGTAAACTATGAGACCATAGGTTGCGAGGTCA
TCGGAAATTTCTTCACCGACAGGAAAGTGTGTGAGGCCAAATGCAAACCG
CCGATCAGTTTTAGAAACAATCCATTCAGTTATTATTTCGAAAGAGCTTT
TAACCAGGCCCGCGATACTTTAAGAAGAATATTCAATCTACCTCAGGCAA
GCTTTCTAGACCAT

BO27334.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-RA 333 CG42462-PA 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-RA 456 CG42462-RA 67..396 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3669321..3669585 346..82 1325 100 Minus
2L 23513712 2L 3669643..3669709 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:33:35 has no hits.

BO27334.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:05 Download gff for BO27334.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 9..338 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:55 Download gff for BO27334.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 67..396 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:57 Download gff for BO27334.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 67..396 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:57 Download gff for BO27334.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669319..3669583 84..348 99 <- Minus
2L 3669643..3669709 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:55 Download gff for BO27334.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3669319..3669583 84..348 99 <- Minus
arm_2L 3669643..3669709 17..83 100   Minus

BO27334.pep Sequence

Translation from 16 to 364

> BO27334.pep
MKFVILLSLMCIGIGYAQQQSEVKCFMDAIPVGECGSRIIGYSYSSVRAR
CVNYETIGCEVIGNFFTDRKVCEAKCKPPISFRNNPFSYYFERAFNQARD
TLRRIFNLPQASFLDH

BO27334.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-PA 110 CG42462-PA 1..110 1..110 589 100 Plus
CG42463-PB 111 CG42463-PB 13..97 7..97 148 35.2 Plus