Clone BO27336 Report

Search the DGRC for BO27336

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptSfp26Ac-RA
Protein status:BO27336.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO27336.complete Sequence

286 bp assembled on 2010-08-18

GenBank Submission: KX793823

> BO27336.complete
GAAGTTATCAGTCGACATGAAGATCCATCTCATATTTGTTATAGTATCTC
TGGTATTGGCGAAAACCATTGCAGACGAATGCCTTACCTGTGACTGGAAA
AGTAATATCCATTGTGGAAAGGTTGCTGATGGCTCATGTGTGTTTACTGC
TCTGAATCGATGCCAAGTTGAAAGAATTTCATGCCGTCGAGAGCAAAAAA
AGCTGAAACCATTCACCGAAATTGTTAAAGGAAAGTGCCCTAAGGACAAA
GAAAAGTGCGCCAAGATGGCAAGCTTTCTAGACCAT

BO27336.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ac-RA 255 CG42469-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ac-RA 309 CG42469-RA 23..275 16..268 1265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5884506..5884677 209..38 860 100 Minus
2L 23513712 2L 5884384..5884442 268..210 295 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:33:45 has no hits.

BO27336.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:07 Download gff for BO27336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 24..275 17..270 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:00 Download gff for BO27336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 24..275 17..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:01 Download gff for BO27336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 24..275 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:01 Download gff for BO27336.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5884382..5884442 210..270 96 <- Minus
2L 5884506..5884676 39..209 100 <- Minus
2L 5884730..5884751 17..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:00 Download gff for BO27336.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5884382..5884442 210..270 96 <- Minus
arm_2L 5884506..5884676 39..209 100 <- Minus
arm_2L 5884730..5884751 17..38 100   Minus

BO27336.pep Sequence

Translation from 16 to 286

> BO27336.pep
MKIHLIFVIVSLVLAKTIADECLTCDWKSNIHCGKVADGSCVFTALNRCQ
VERISCRREQKKLKPFTEIVKGKCPKDKEKCAKMASFLDH

BO27336.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ac-PA 84 CG42469-PA 1..84 1..84 451 100 Plus