BO27338.complete Sequence
235 bp assembled on 2010-09-07
GenBank Submission: KX799113
> BO27338.complete
GAAGTTATCAGTCGACATGCTGGACCCCATTTCGGACGCACCGCTGGTCT
TGGCCTACGTCTTTATGTCGCTGCTGGTGCTCATTGTGTGCTTCATACTG
GTCAATGTGGTCCACAAGCTGTATCGCAGTCTCAACGGCGAGGTATCAAC
GGGGCTGGTTTCTCCGGCACAGCAGCTGAAGACCTCCATCATGGAGCTAG
ACGCCATGAAGACCGGTGCAAGCTTTCTAGACCAT
BO27338.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13255-RB | 204 | CG13255-PB | 1..201 | 17..217 | 1005 | 100 | Plus |
CG13255-RA | 204 | CG13255-PA | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13255-RB | 1352 | CG13255-RB | 890..1095 | 12..217 | 1015 | 99.5 | Plus |
CG13255-RA | 940 | CG13255-RA | 478..683 | 12..217 | 1015 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 20838377..20838582 | 12..217 | 1015 | 99.5 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:46:34 has no hits.
BO27338.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:08 Download gff for
BO27338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13255-RA | 483..683 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:37 Download gff for
BO27338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13255-RA | 483..683 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:07 Download gff for
BO27338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13255-RA | 483..683 | 17..219 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:07 Download gff for
BO27338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20838382..20838582 | 17..219 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:37 Download gff for
BO27338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 20831482..20831682 | 17..219 | 99 | | Plus |
BO27338.pep Sequence
Translation from 16 to 235
> BO27338.pep
MLDPISDAPLVLAYVFMSLLVLIVCFILVNVVHKLYRSLNGEVSTGLVSP
AQQLKTSIMELDAMKTGASFLDH
BO27338.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13255-PB | 67 | CG13255-PB | 1..67 | 1..67 | 327 | 100 | Plus |
CG13255-PA | 67 | CG13255-PA | 1..67 | 1..67 | 327 | 100 | Plus |