Clone BO27338 Report

Search the DGRC for BO27338

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG13255-RA
Protein status:BO27338.pep: Inserted from web
Sequenced Size:235

Clone Sequence Records

BO27338.complete Sequence

235 bp assembled on 2010-09-07

GenBank Submission: KX799113

> BO27338.complete
GAAGTTATCAGTCGACATGCTGGACCCCATTTCGGACGCACCGCTGGTCT
TGGCCTACGTCTTTATGTCGCTGCTGGTGCTCATTGTGTGCTTCATACTG
GTCAATGTGGTCCACAAGCTGTATCGCAGTCTCAACGGCGAGGTATCAAC
GGGGCTGGTTTCTCCGGCACAGCAGCTGAAGACCTCCATCATGGAGCTAG
ACGCCATGAAGACCGGTGCAAGCTTTCTAGACCAT

BO27338.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13255-RB 204 CG13255-PB 1..201 17..217 1005 100 Plus
CG13255-RA 204 CG13255-PA 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13255-RB 1352 CG13255-RB 890..1095 12..217 1015 99.5 Plus
CG13255-RA 940 CG13255-RA 478..683 12..217 1015 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20838377..20838582 12..217 1015 99.5 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:34 has no hits.

BO27338.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:08 Download gff for BO27338.complete
Subject Subject Range Query Range Percent Splice Strand
CG13255-RA 483..683 17..219 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:37 Download gff for BO27338.complete
Subject Subject Range Query Range Percent Splice Strand
CG13255-RA 483..683 17..219 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:07 Download gff for BO27338.complete
Subject Subject Range Query Range Percent Splice Strand
CG13255-RA 483..683 17..219 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:07 Download gff for BO27338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20838382..20838582 17..219 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:37 Download gff for BO27338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20831482..20831682 17..219 99   Plus

BO27338.pep Sequence

Translation from 16 to 235

> BO27338.pep
MLDPISDAPLVLAYVFMSLLVLIVCFILVNVVHKLYRSLNGEVSTGLVSP
AQQLKTSIMELDAMKTGASFLDH

BO27338.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13255-PB 67 CG13255-PB 1..67 1..67 327 100 Plus
CG13255-PA 67 CG13255-PA 1..67 1..67 327 100 Plus