Clone BO27354 Report

Search the DGRC for BO27354

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG15034-RA
Protein status:BO27354.pep: Imported from assembly
Sequenced Size:346

Clone Sequence Records

BO27354.complete Sequence

346 bp assembled on 2010-08-18

GenBank Submission: KX798055

> BO27354.complete
GAAGTTATCAGTCGACATGGCGTTAAAGATGAATCAATACCAGAACCAGG
TCAAGATAAACTACGTGCAACAATATGTGGGTAGGGTGGCTGGTCCCCTA
GTCGAGCCCATTTTCCCCGTGCCGCAAATGTCATCGGCAACCCTACGAGT
CCGTCGAGCTGTCGTCGAATCCTATCGCGGACCCCAAATTGCTCCCGATG
ATGCCATGCTCCCGATGCCGCCCCACAACAAGGCTCAAAATATGTCTGAG
ATTCTGCACGACCTTCAATTCAAGCTGAAAGATTTCAAGCTGTGGAATCA
AGTCATTCGTCTTCTGAAGAAACGGGTCGCAAGCTTTCTAGACCAT

BO27354.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-RB 315 CG15034-PB 1..312 17..328 1560 100 Plus
CG15034-RA 315 CG15034-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-RB 1248 CG15034-RB 215..527 16..328 1565 100 Plus
CG15034-RA 794 CG15034-RA 215..527 16..328 1565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7346980..7347292 328..16 1565 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:34:50 has no hits.

BO27354.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:21 Download gff for BO27354.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 204..515 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:22 Download gff for BO27354.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 216..527 17..330 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:21 Download gff for BO27354.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 216..527 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:21 Download gff for BO27354.complete
Subject Subject Range Query Range Percent Splice Strand
X 7346978..7347291 17..330 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:22 Download gff for BO27354.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7241011..7241324 17..330 99   Minus

BO27354.pep Sequence

Translation from 16 to 346

> BO27354.pep
MALKMNQYQNQVKINYVQQYVGRVAGPLVEPIFPVPQMSSATLRVRRAVV
ESYRGPQIAPDDAMLPMPPHNKAQNMSEILHDLQFKLKDFKLWNQVIRLL
KKRVASFLDH

BO27354.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-PB 104 CG15034-PB 1..104 1..104 537 100 Plus
CG15034-PA 104 CG15034-PA 1..104 1..104 537 100 Plus