Clone BO27365 Report

Search the DGRC for BO27365

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG17777-RB
Protein status:BO27365.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO27365.complete Sequence

364 bp assembled on 2010-08-18

GenBank Submission: KX796690

> BO27365.complete
GAAGTTATCAGTCGACATGAAGTTCTTGTGCGTGTTCGTCATCCTGGCCA
TTTGCTTCATGAGCACCTGGGCAGCAGTTTCGGAGCCTGCTCCTGAAGCT
CTGGAGCCGGAGCCATCCGCCGTGGATGAGAAGAAGACGGAGAAGAGAGG
CATCTACGGGTTCGGCCACGGCTATGGCGGCTACGGCGGATACGGCGGAT
ACGGTGCCTATGGACACGGTCACTACGGCGGCTACGGTGGACTGAGCAGT
CCCTACTACGGCGGCTACGGATACGTCCATGCGGCGCCCTACTACGGCGG
ACACCACGGCTACTATCCGTACCACCATGGCCACTACGGCTTCTACGCAA
GCTTTCTAGACCAT

BO27365.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-RC 333 CG17777-PC 1..330 17..346 1650 100 Plus
CG17777-RB 333 CG17777-PB 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-RC 680 CG17777-RC 73..404 15..346 1660 100 Plus
CG17777-RB 561 CG17777-RB 73..404 15..346 1660 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2187147..2187465 28..346 1595 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:35:31 has no hits.

BO27365.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:30 Download gff for BO27365.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 75..404 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:35 Download gff for BO27365.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 75..404 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:32 Download gff for BO27365.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 75..404 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:32 Download gff for BO27365.complete
Subject Subject Range Query Range Percent Splice Strand
X 2187142..2187465 22..348 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:35 Download gff for BO27365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2081175..2081498 22..348 98   Plus

BO27365.pep Sequence

Translation from 16 to 364

> BO27365.pep
MKFLCVFVILAICFMSTWAAVSEPAPEALEPEPSAVDEKKTEKRGIYGFG
HGYGGYGGYGGYGAYGHGHYGGYGGLSSPYYGGYGYVHAAPYYGGHHGYY
PYHHGHYGFYASFLDH

BO27365.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-PC 110 CG17777-PC 1..110 1..110 648 100 Plus
CG17777-PB 110 CG17777-PB 1..110 1..110 648 100 Plus
CG13050-PA 143 CG13050-PA 1..123 1..103 160 38.1 Plus
CG9269-PA 146 CG9269-PA 55..119 45..99 158 55.2 Plus
CG17738-PA 110 CG17738-PA 60..105 48..98 147 54.7 Plus