BO27366.complete Sequence
382 bp assembled on 2010-08-18
GenBank Submission: KX799678
> BO27366.complete
GAAGTTATCAGTCGACATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCG
TTGCCTGCGCTGCTGCCAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTAC
ACTGCTCCTCTGGCTTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCCGC
TCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAATG
GAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTGCT
CCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCACCACTGGCCTA
CTCCTCTCCTTTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTTCAG
GACCGCTCCTTATCGCAAGCTTTCTAGACCAT
BO27366.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:35:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32214-RC | 351 | CG32214-PC | 1..348 | 17..364 | 1740 | 100 | Plus |
CG32214-RB | 351 | CG32214-PB | 1..348 | 17..364 | 1740 | 100 | Plus |
825-Oak-RB | 390 | CG32208-PB | 1..272 | 17..288 | 1360 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:35:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32214-RC | 756 | CG32214-RC | 54..402 | 16..364 | 1745 | 100 | Plus |
CG32214-RB | 465 | CG32214-RB | 54..402 | 16..364 | 1745 | 100 | Plus |
825-Oak-RB | 514 | CG32208-RB | 51..323 | 16..288 | 1365 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:35:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 19467471..19467806 | 29..364 | 1680 | 100 | Plus |
3L | 28110227 | 3L | 19471847..19472106 | 288..29 | 1300 | 100 | Minus |
3L | 28110227 | 3L | 19475961..19476220 | 29..288 | 1270 | 99.2 | Plus |
3L | 28110227 | 3L | 19472620..19472844 | 39..245 | 700 | 88.4 | Plus |
3L | 28110227 | 3L | 19475223..19475447 | 245..39 | 700 | 88.4 | Minus |
3L | 28110227 | 3L | 19466728..19466952 | 245..39 | 685 | 88 | Minus |
3L | 28110227 | 3L | 19472858..19472990 | 232..364 | 530 | 93.2 | Plus |
3L | 28110227 | 3L | 19471750..19471863 | 346..233 | 510 | 96.5 | Minus |
3L | 28110227 | 3L | 19476204..19476317 | 233..346 | 510 | 96.5 | Plus |
3L | 28110227 | 3L | 19423906..19424044 | 88..226 | 485 | 89.9 | Plus |
3L | 28110227 | 3L | 19478430..19478568 | 88..226 | 485 | 89.9 | Plus |
3L | 28110227 | 3L | 19423002..19423298 | 341..54 | 415 | 78.3 | Minus |
3L | 28110227 | 3L | 19486803..19486968 | 363..197 | 410 | 84.4 | Minus |
3L | 28110227 | 3L | 19488102..19488245 | 88..240 | 295 | 81 | Plus |
3L | 28110227 | 3L | 19488045..19488123 | 49..127 | 275 | 89.9 | Plus |
3L | 28110227 | 3L | 19424757..19424836 | 141..220 | 265 | 88.8 | Plus |
3L | 28110227 | 3L | 19477672..19477760 | 364..276 | 265 | 86.5 | Minus |
3L | 28110227 | 3L | 19464433..19464518 | 225..140 | 205 | 82.6 | Minus |
3L | 28110227 | 3L | 19478373..19478428 | 49..104 | 205 | 91.1 | Plus |
3L | 28110227 | 3L | 19423849..19423904 | 49..104 | 190 | 89.3 | Plus |
Blast to na_te.dros performed 2014-11-28 02:35:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2764..2999 | 258..30 | 152 | 57.5 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2777..2891 | 159..42 | 151 | 60.2 | Minus |
BO27366.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:31 Download gff for
BO27366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
825-Oak-RB | 57..325 | 22..290 | 99 | <- | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:37 Download gff for
BO27366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32214-RB | 60..402 | 22..366 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:34 Download gff for
BO27366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32214-RB | 60..402 | 22..366 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:34 Download gff for
BO27366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19467466..19467806 | 22..366 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:37 Download gff for
BO27366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 19460566..19460906 | 22..366 | 98 | | Plus |
BO27366.pep Sequence
Translation from 16 to 382
> BO27366.pep
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTA
TSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPLAYSSPLA
YSAPLSYAAASGPLLIASFLDH
BO27366.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:08:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32214-PC | 116 | CG32214-PC | 1..116 | 1..116 | 562 | 100 | Plus |
CG32214-PB | 116 | CG32214-PB | 1..116 | 1..116 | 562 | 100 | Plus |
825-Oak-PB | 129 | CG32208-PB | 1..129 | 1..116 | 523 | 87.6 | Plus |
CG32213-PB | 129 | CG32213-PB | 1..129 | 1..116 | 520 | 86.8 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..131 | 1..116 | 498 | 84 | Plus |