Clone BO27370 Report

Search the DGRC for BO27370

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG34293-RA
Protein status:BO27370.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO27370.complete Sequence

286 bp assembled on 2010-08-18

GenBank Submission: KX797025

> BO27370.complete
GAAGTTATCAGTCGACATGTTAAATTTAAAACACTTTGCCAGCCACGCCT
ACCGCCAGTACGAACTGGTGACGTGCGTGAACATGCTGGAGCCCTGGGAA
AAGAAGCTGATCAATGGATTCTTTCTGGTGATGCTGCTCCTGGTGCTCTT
CTCCAGCTTCATGTATCTTCCCAACTACATGCAAACCCTAATGCAATTTG
TAACGCCGCCCAACTGGCACAATTCCCCGGATAGCGCAGCCTATGTGGCA
CAAAAGATCGCACGGAGCGCAAGCTTTCTAGACCAT

BO27370.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-RB 255 CG34293-PB 1..252 17..268 1260 100 Plus
CG34293-RA 255 CG34293-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-RB 740 CG34293-RB 48..299 17..268 1260 100 Plus
CG34293-RA 446 CG34293-RA 48..299 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27165216..27165370 268..114 775 100 Minus
3R 32079331 3R 27165432..27165528 113..17 485 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:36:00 has no hits.

BO27370.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:36 Download gff for BO27370.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 53..299 22..270 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:46 Download gff for BO27370.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 53..299 22..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:42 Download gff for BO27370.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 53..299 22..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:42 Download gff for BO27370.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27165213..27165370 114..270 98 <- Minus
3R 27165432..27165523 22..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:46 Download gff for BO27370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22991154..22991245 22..113 100   Minus
arm_3R 22990935..22991092 114..270 98 <- Minus

BO27370.pep Sequence

Translation from 16 to 286

> BO27370.pep
MLNLKHFASHAYRQYELVTCVNMLEPWEKKLINGFFLVMLLLVLFSSFMY
LPNYMQTLMQFVTPPNWHNSPDSAAYVAQKIARSASFLDH

BO27370.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-PB 84 CG34293-PB 1..84 1..84 447 100 Plus
CG34293-PA 84 CG34293-PA 1..84 1..84 447 100 Plus