Clone BO27372 Report

Search the DGRC for BO27372

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptLysD-RA
Protein status:BO27372.pep: Imported from assembly
Sequenced Size:454

Clone Sequence Records

BO27372.complete Sequence

454 bp assembled on 2010-08-18

GenBank Submission: KX798732

> BO27372.complete
GAAGTTATCAGTCGACATGAAGGCTTTCATCGTTCTGGTTGCCCTGGCCT
GTGCCGCCCCAGCTTTCGGTCGCACCATGGACCGTTGCTCCCTGGCCCGC
GAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCGTTGGGCCTG
TATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTTGGTCCCGAGA
ACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAACGACTACTAC
TGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAACGAATGCGGATTGAG
CTGCAACGCTCTCCTGACCGACGACATCACCCACTCCGTCCGTTGTGCCC
AGAAGGTCCTCAGCCAGCAGGGATGGTCCGCCTGGTCCACCTGGCACTAC
TGCAGCGGATGGTTGCCGTCCATCGATGACTGCTTCGCAAGCTTTCTAGA
CCAT

BO27372.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
LysD-RA 423 CG9118-PA 1..420 17..436 2100 100 Plus
LysB-RB 423 CG1179-PB 1..420 17..436 1860 96.2 Plus
LysB-RA 423 CG1179-PA 1..420 17..436 1860 96.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
LysD-RA 480 CG9118-RA 19..439 16..436 2105 100 Plus
LysB-RB 611 CG1179-RB 22..443 15..436 1870 96.2 Plus
LysB-RA 486 CG1179-RA 22..443 15..436 1870 96.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1210758..1211178 436..16 2105 100 Minus
3L 28110227 3L 1207392..1207813 15..436 1870 96.2 Plus
3L 28110227 3L 1212952..1213371 17..436 1800 95.2 Plus
3L 28110227 3L 1210484..1210726 16..258 1020 94.7 Plus
3L 28110227 3L 1227770..1228191 15..436 900 81.9 Plus
3L 28110227 3L 1218286..1218607 410..89 635 79.8 Minus
3L 28110227 3L 1194874..1195241 435..68 625 78 Minus
Blast to na_te.dros performed on 2014-11-28 02:36:05 has no hits.

BO27372.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:38 Download gff for BO27372.complete
Subject Subject Range Query Range Percent Splice Strand
LysD-RA 20..439 17..438 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:47 Download gff for BO27372.complete
Subject Subject Range Query Range Percent Splice Strand
LysD-RA 20..439 17..438 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:44 Download gff for BO27372.complete
Subject Subject Range Query Range Percent Splice Strand
LysD-RA 20..439 17..438 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:44 Download gff for BO27372.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1210756..1211177 17..438 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:47 Download gff for BO27372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1210756..1211177 17..438 99   Minus

BO27372.pep Sequence

Translation from 16 to 454

> BO27372.pep
MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCFASFLDH

BO27372.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
LysD-PA 140 CG9118-PA 1..140 1..140 786 100 Plus
LysC-PA 140 CG9111-PA 1..140 1..140 777 98.6 Plus
LysB-PB 140 CG1179-PB 1..140 1..140 770 98.6 Plus
LysB-PA 140 CG1179-PA 1..140 1..140 770 98.6 Plus
LysE-PA 140 CG1180-PA 1..140 1..140 755 96.4 Plus