BO27373.complete Sequence
295 bp assembled on 2010-08-18
GenBank Submission: KX795913
> BO27373.complete
GAAGTTATCAGTCGACATGAGCAAAGTAACCTTCAAAATCACGCTAACTT
CGGACCCCAAGCTGCCCTTTAAGGTGCTTAGTGTTCCGGAGGGAACTCCC
TTTACGGCTGTGCTGAAATTCGCCTCTGAAGAGTTCAAGGTTCCGGCGGA
GACGAGTGCCATCATCACGGACGATGGAATTGGCATCAGCCCACAGCAGA
CTGCTGGTAATGTGTTCCTAAAGCACGGATCCGAGCTGCGCCTCATACCC
AGAGATCGAGTGGGCCACCAACTAAGCGCAAGCTTTCTAGACCAT
BO27373.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:36:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-RA | 264 | CG34191-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
CG34191-RB | 264 | CG34191-PB | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:36:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-RA | 647 | CG34191-RA | 304..564 | 17..277 | 1305 | 100 | Plus |
CG34191-RB | 479 | CG34191-RB | 136..396 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:36:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16952238..16952498 | 17..277 | 1305 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:36:10 has no hits.
BO27373.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:39 Download gff for
BO27373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..261 | 17..279 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:49 Download gff for
BO27373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 136..396 | 17..279 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:46 Download gff for
BO27373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 136..396 | 17..279 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:46 Download gff for
BO27373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16952238..16952498 | 17..279 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:49 Download gff for
BO27373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12839743..12840003 | 17..279 | 99 | | Plus |
BO27373.pep Sequence
Translation from 16 to 295
> BO27373.pep
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLSASFLDH
BO27373.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:08:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-PA | 87 | CG34191-PA | 1..87 | 1..87 | 438 | 100 | Plus |
CG34191-PB | 87 | CG34191-PB | 1..87 | 1..87 | 438 | 100 | Plus |