BO27376.complete Sequence
319 bp assembled on 2010-08-18
GenBank Submission: KX798325
> BO27376.complete
GAAGTTATCAGTCGACATGTCCAAGATTACTCTGTTTATTGCTTTTATTT
GCCTTTTCGTTATCGTTCAGGCCCAAAGTGATAGAGATATTTGTAGACGG
ATTGTCGCCAGATGTGAGTCAAGGGTCGTGAGAAATGGCAGAAACAACGA
TATTTCGAATATTTTCAATGAGAACTGTCGGCGAACACAAAGAAATTGGC
GTGAAATCTCCCGATGCGAACTCGCAAAAGCTAATTGTATATTGACCCTT
GAGCGATGTAACACGTTGTCCTGCGAGAATGTCCGGCGAGCCCTTGCACA
AGCAAGCTTTCTAGACCAT
BO27376.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Eb-RB | 288 | CG7355-PB | 1..285 | 17..301 | 1425 | 100 | Plus |
Eig71Eb-RA | 288 | CG7355-PA | 1..285 | 17..301 | 1425 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Eb-RB | 425 | CG7355-RB | 49..333 | 17..301 | 1425 | 100 | Plus |
Eig71Eb-RA | 472 | CG7355-RA | 49..333 | 17..301 | 1425 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15650082..15650283 | 41..242 | 1010 | 100 | Plus |
3L | 28110227 | 3L | 15650344..15650402 | 243..301 | 295 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:54:52 has no hits.
BO27376.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:35 Download gff for
BO27376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Eb-RA | 24..308 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:30 Download gff for
BO27376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Eb-RA | 49..333 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:20 Download gff for
BO27376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Eb-RA | 49..333 | 17..303 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:20 Download gff for
BO27376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15649984..15650008 | 17..41 | 100 | -> | Plus |
3L | 15650083..15650283 | 42..242 | 100 | -> | Plus |
3L | 15650344..15650402 | 243..303 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:30 Download gff for
BO27376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15643084..15643108 | 17..41 | 100 | -> | Plus |
arm_3L | 15643183..15643383 | 42..242 | 100 | -> | Plus |
arm_3L | 15643444..15643502 | 243..303 | 96 | | Plus |
BO27376.pep Sequence
Translation from 16 to 319
> BO27376.pep
MSKITLFIAFICLFVIVQAQSDRDICRRIVARCESRVVRNGRNNDISNIF
NENCRRTQRNWREISRCELAKANCILTLERCNTLSCENVRRALAQASFLD
H
BO27376.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Eb-PB | 95 | CG7355-PB | 1..95 | 1..95 | 495 | 100 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..95 | 1..95 | 495 | 100 | Plus |
Eig71Ec-PA | 173 | CG7608-PA | 1..96 | 1..93 | 241 | 51 | Plus |
Eig71Eg-PA | 98 | CG7336-PA | 1..96 | 1..93 | 214 | 42.7 | Plus |
Eig71Ei-PB | 102 | CG7327-PB | 1..95 | 1..89 | 171 | 35.8 | Plus |