Clone BO27376 Report

Search the DGRC for BO27376

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptEig71Eb-RA
Protein status:BO27376.pep: Imported from assembly
Sequenced Size:319

Clone Sequence Records

BO27376.complete Sequence

319 bp assembled on 2010-08-18

GenBank Submission: KX798325

> BO27376.complete
GAAGTTATCAGTCGACATGTCCAAGATTACTCTGTTTATTGCTTTTATTT
GCCTTTTCGTTATCGTTCAGGCCCAAAGTGATAGAGATATTTGTAGACGG
ATTGTCGCCAGATGTGAGTCAAGGGTCGTGAGAAATGGCAGAAACAACGA
TATTTCGAATATTTTCAATGAGAACTGTCGGCGAACACAAAGAAATTGGC
GTGAAATCTCCCGATGCGAACTCGCAAAAGCTAATTGTATATTGACCCTT
GAGCGATGTAACACGTTGTCCTGCGAGAATGTCCGGCGAGCCCTTGCACA
AGCAAGCTTTCTAGACCAT

BO27376.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-RB 288 CG7355-PB 1..285 17..301 1425 100 Plus
Eig71Eb-RA 288 CG7355-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-RB 425 CG7355-RB 49..333 17..301 1425 100 Plus
Eig71Eb-RA 472 CG7355-RA 49..333 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15650082..15650283 41..242 1010 100 Plus
3L 28110227 3L 15650344..15650402 243..301 295 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:54:52 has no hits.

BO27376.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:35 Download gff for BO27376.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 24..308 17..303 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:30 Download gff for BO27376.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 49..333 17..303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:20 Download gff for BO27376.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 49..333 17..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:20 Download gff for BO27376.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15649984..15650008 17..41 100 -> Plus
3L 15650083..15650283 42..242 100 -> Plus
3L 15650344..15650402 243..303 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:30 Download gff for BO27376.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15643084..15643108 17..41 100 -> Plus
arm_3L 15643183..15643383 42..242 100 -> Plus
arm_3L 15643444..15643502 243..303 96   Plus

BO27376.pep Sequence

Translation from 16 to 319

> BO27376.pep
MSKITLFIAFICLFVIVQAQSDRDICRRIVARCESRVVRNGRNNDISNIF
NENCRRTQRNWREISRCELAKANCILTLERCNTLSCENVRRALAQASFLD
H

BO27376.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-PB 95 CG7355-PB 1..95 1..95 495 100 Plus
Eig71Eb-PA 95 CG7355-PA 1..95 1..95 495 100 Plus
Eig71Ec-PA 173 CG7608-PA 1..96 1..93 241 51 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 1..93 214 42.7 Plus
Eig71Ei-PB 102 CG7327-PB 1..95 1..89 171 35.8 Plus