Clone BO27382 Report

Search the DGRC for BO27382

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG33333-RA
Protein status:BO27382.pep: Imported from assembly
Sequenced Size:478

Clone Sequence Records

BO27382.complete Sequence

478 bp assembled on 2010-09-22

GenBank Submission: KX796916

> BO27382.complete
GAAGTTATCAGTCGACATGGCAGTCGGCTTCATTGTAATCTTCAGCGCCA
TATTCGTCCTGGCCCAAGGATCAAATCTTTTGCCCATTGAGCAGCAATCG
GAGGTGCCAATCCATTCTGGTGCTCCAGCGGCAGTCATTTCGCAAGGACA
ACAGTCTGTGTCCCAGTCCGTTGGTTCTGCTTACGGTCAAGACCAAGGGT
TGGCTGGTGCACGACCCTATTGGGCTGCACCTCGTCCTGCTCTGGCTGCA
CCTCGTCCTGCTGAGTCCTACGCTCGTCCTGCTGTGGCTGTACCTCGTCC
TTCTGTGGCTGCACCTCGTCCGGCTGTGTCCTACGCTCGTCCTGCAGCCG
TGGTGGTTCCTGCTTTGGTGGTTGCTCCTATTCGCCAGCCTCAGGGAGTC
CCTGTCCCAGCCGTTGTAGGAGCTAGTCAAGGAAATGTGTACCATGGTCG
CCATCATGGCGCAAGCTTTCTAGACCAT

BO27382.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-RA 447 CG33333-PA 1..444 17..460 2220 100 Plus
CG33333-RA 447 CG33333-PA 270..329 223..282 225 91.7 Plus
CG33333-RA 447 CG33333-PA 207..266 286..345 225 91.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-RA 576 CG33333-RA 18..461 17..460 2220 100 Plus
CG33333-RA 576 CG33333-RA 224..283 286..345 225 91.7 Plus
CG33333-RA 576 CG33333-RA 287..346 223..282 225 91.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17417484..17417927 17..460 2220 100 Plus
3R 32079331 3R 17417690..17417749 286..345 225 91.7 Plus
3R 32079331 3R 17417753..17417812 223..282 225 91.7 Plus
Blast to na_te.dros performed on 2014-11-28 07:56:26 has no hits.

BO27382.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-22 18:49:46 Download gff for BO27382.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..444 17..462 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:12 Download gff for BO27382.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 18..461 17..462 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:07:27 Download gff for BO27382.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 18..461 17..462 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:07:27 Download gff for BO27382.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17417484..17417927 17..462 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:12 Download gff for BO27382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13243206..13243649 17..462 99   Plus

BO27382.pep Sequence

Translation from 16 to 478

> BO27382.pep
MAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIHSGAPAAVISQGQQSVSQ
SVGSAYGQDQGLAGARPYWAAPRPALAAPRPAESYARPAVAVPRPSVAAP
RPAVSYARPAAVVVPALVVAPIRQPQGVPVPAVVGASQGNVYHGRHHGAS
FLDH

BO27382.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-PA 148 CG33333-PA 1..148 1..148 750 100 Plus
CG42834-PA 122 CG42834-PA 1..103 1..88 139 36.1 Plus