Clone BO27389 Report

Search the DGRC for BO27389

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptOs-C-RC
Protein status:BO27389.pep: Imported from assembly
Sequenced Size:439

Clone Sequence Records

BO27389.complete Sequence

439 bp assembled on 2010-08-18

GenBank Submission: KX800004

> BO27389.complete
GAAGTTATCAGTCGACATGGGTTTTCACATGGGACGACAGCTGCTACTCT
CCGGATTCCTGCTGGTGATGCTTCAGATGGTGACCCAAACGCAGGCCAGG
CCGCAGGATGTGATCACAGTTGCTGGCGAGGAGACAGAGGTGGTGATCAA
GCGGGAGGGCGATGACGATGGAGACGACGATGACTCCTCCTCCGAGGAAA
CAGTCGAGGATTCCGAGGAAAGCAGACGCAGACGACGCGAGGTGAATACG
GACAACACGCCATCGGCTCGAGCGGTTATTCCAGGCGAGCAAGTAGTCCC
CATTCTCTTGGAGGCCATTCTTCCCAGCGTGGATGCAGCGGGCGATCGCT
TCGCAAGATCTGTGCAATTTCTGAAAAACTTGACCCCTGGCTCTGAATTG
TTTGCCGTCGAGAAGAACGAAGCAAGCTTTCTAGACCAT

BO27389.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
Os-C-RC 408 CG3250-PC 1..405 17..421 2025 100 Plus
Os-C-RD 396 CG3250-PD 1..393 17..421 1810 97 Plus
Os-C-RB 462 CG3250-PB 1..269 17..285 1345 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
Os-C-RC 550 CG3250-RC 17..421 17..421 2025 100 Plus
Os-C-RD 538 CG3250-RD 17..409 17..421 1810 97 Plus
Os-C-RB 604 CG3250-RB 17..285 17..285 1345 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7979114..7979295 104..285 910 100 Plus
3R 32079331 3R 7979347..7979485 283..421 695 100 Plus
3R 32079331 3R 7978975..7979065 17..107 455 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:55:22 has no hits.

BO27389.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:42 Download gff for BO27389.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 17..421 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:43 Download gff for BO27389.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 17..421 17..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:29 Download gff for BO27389.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 17..421 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:29 Download gff for BO27389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7978975..7979064 17..106 100 -> Plus
3R 7979117..7979294 107..284 100 -> Plus
3R 7979349..7979485 285..423 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:43 Download gff for BO27389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3804697..3804786 17..106 100 -> Plus
arm_3R 3804839..3805016 107..284 100 -> Plus
arm_3R 3805071..3805207 285..423 98   Plus

BO27389.pep Sequence

Translation from 16 to 439

> BO27389.pep
MGFHMGRQLLLSGFLLVMLQMVTQTQARPQDVITVAGEETEVVIKREGDD
DGDDDDSSSEETVEDSEESRRRRREVNTDNTPSARAVIPGEQVVPILLEA
ILPSVDAAGDRFARSVQFLKNLTPGSELFAVEKNEASFLDH

BO27389.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
Os-C-PC 135 CG3250-PC 1..135 1..135 670 100 Plus
Os-C-PB 153 CG3250-PB 1..153 1..135 641 88.2 Plus
Os-C-PD 131 CG3250-PD 1..131 1..135 635 97 Plus