Clone BO27393 Report

Search the DGRC for BO27393

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:273
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG34191-RA
Protein status:BO27393.pep: full length peptide match
Sequenced Size:295

Clone Sequence Records

BO27393.complete Sequence

295 bp assembled on 2010-08-18

GenBank Submission: KX795930

> BO27393.complete
GAAGTTATCAGTCGACATGAGCAAAGTAACCTTCAAAATCACGCTAACTT
CGGACCCCAAGCTGCCCTTTAAGGTGCTTAGTGTTCCGGAGGGAACTCCC
TTTACGGCTGTGCTGAAATTCGCCTCTGAAGAGTTCAAGGTTCCGGCGGA
GACGAGTGCCATCATCACGGACGATGGAATTGGCATCAGCCCACAGCAGA
CTGCTGGTAATGTGTTCCTAAAGCACGGATCCGAGCTGCGCCTCATACCC
AGAGATCGAGTGGGCCACCAACTAAGCGCAAGCTTTCTAGACCAT

BO27393.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-RA 264 CG34191-PA 1..261 17..277 1305 100 Plus
CG34191-RB 264 CG34191-PB 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-RA 647 CG34191-RA 304..564 17..277 1305 100 Plus
CG34191-RB 479 CG34191-RB 136..396 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16952238..16952498 17..277 1305 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:55:40 has no hits.

BO27393.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:45 Download gff for BO27393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..261 17..279 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:49 Download gff for BO27393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 136..396 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:34 Download gff for BO27393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 136..396 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:34 Download gff for BO27393.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16952238..16952498 17..279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:49 Download gff for BO27393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12839743..12840003 17..279 99   Plus

BO27393.pep Sequence

Translation from 16 to 295

> BO27393.pep
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLSASFLDH

BO27393.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-PA 87 CG34191-PA 1..87 1..87 438 100 Plus
CG34191-PB 87 CG34191-PB 1..87 1..87 438 100 Plus