Clone BO27460 Report

Search the DGRC for BO27460

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:274
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG13059-RA
Protein status:BO27460.pep: Imported from assembly
Sequenced Size:499

Clone Sequence Records

BO27460.complete Sequence

499 bp assembled on 2010-08-18

GenBank Submission: KX796942

> BO27460.complete
GAAGTTATCAGTCGACATGTTCAAATTCGTCGCCTTCTTCGCTTGCCTGG
CTGTGGCCGCCGCTGCCCCCGGTCTGATTGCCGAGACCCACTCGATTGTC
CAGCCGGCGATTCTTGCCAAGACTGCCTACGTGGACACCAGCGCCTCCTC
GGCCATCACCCACCAGAGCAACGTGAACCTGGTGCGCAAGGTGCCAGTGG
TCTACTCCGCCCCGGTTGTTCATGCTGCCCCAGTGGTACATGCCGCTCCT
CTGGTCAAGACTGTGATCCCTGCCGCTCCCCTGGTCAAGACTGTGATCCC
TGCCGCTCCCGTCCTTAAGACTGTGGTCTCCTCTGCTCCTCTGGTCCACA
CTGTCGTCCCAGCCGCTCCACTGGTCAAGACCGTCATCCCAGCTGCTCCG
GTTATCAAGACCGTGATCCCAGCTGCCCCTCTGGTTCACACCGTCCACAG
CGCCCCAGTTGTCTACTCCGCCTACCACAAGGCAAGCTTTCTAGACCAT

BO27460.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13059-RA 468 CG13059-PA 1..465 17..481 2325 100 Plus
CG13059-RA 468 CG13059-PA 225..380 271..426 285 78.8 Plus
CG13059-RA 468 CG13059-PA 255..410 241..396 285 78.8 Plus
CG13059-RA 468 CG13059-PA 229..339 335..445 225 80.2 Plus
CG13059-RA 468 CG13059-PA 319..429 245..355 225 80.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13059-RA 572 CG13059-RA 60..524 17..481 2325 100 Plus
CG13059-RA 572 CG13059-RA 284..439 271..426 285 78.8 Plus
CG13059-RA 572 CG13059-RA 314..469 241..396 285 78.8 Plus
CG13059-RA 572 CG13059-RA 288..398 335..445 225 80.2 Plus
CG13059-RA 572 CG13059-RA 378..488 245..355 225 80.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16323808..16324260 29..481 2265 100 Plus
3L 28110227 3L 16324020..16324175 271..426 285 78.8 Plus
3L 28110227 3L 16324050..16324205 241..396 285 78.8 Plus
3L 28110227 3L 16324024..16324134 335..445 225 80.2 Plus
3L 28110227 3L 16324114..16324224 245..355 225 80.2 Plus
Blast to na_te.dros performed 2014-11-28 02:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dnet\R1B 2038 Dnet\R1B NETR1B 2038bp 1288..1328 269..230 121 80.5 Minus

BO27460.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:47 Download gff for BO27460.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 6..465 22..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:41 Download gff for BO27460.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 65..524 22..483 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:24 Download gff for BO27460.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 65..524 22..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:24 Download gff for BO27460.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16323803..16324260 22..483 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:41 Download gff for BO27460.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16316903..16317360 22..483 98   Plus

BO27460.pep Sequence

Translation from 16 to 499

> BO27460.pep
MFKFVAFFACLAVAAAAPGLIAETHSIVQPAILAKTAYVDTSASSAITHQ
SNVNLVRKVPVVYSAPVVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVL
KTVVSSAPLVHTVVPAAPLVKTVIPAAPVIKTVIPAAPLVHTVHSAPVVY
SAYHKASFLDH

BO27460.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13059-PA 155 CG13059-PA 1..155 1..155 764 100 Plus
CG13040-PB 185 CG13040-PB 1..151 1..161 242 38.9 Plus
CG13040-PA 185 CG13040-PA 1..151 1..161 242 38.9 Plus
CG13060-PA 131 CG13060-PA 1..131 1..154 213 42.9 Plus
CG13041-PA 124 CG13041-PA 1..123 1..144 203 45.2 Plus