BO27460.complete Sequence
499 bp assembled on 2010-08-18
GenBank Submission: KX796942
> BO27460.complete
GAAGTTATCAGTCGACATGTTCAAATTCGTCGCCTTCTTCGCTTGCCTGG
CTGTGGCCGCCGCTGCCCCCGGTCTGATTGCCGAGACCCACTCGATTGTC
CAGCCGGCGATTCTTGCCAAGACTGCCTACGTGGACACCAGCGCCTCCTC
GGCCATCACCCACCAGAGCAACGTGAACCTGGTGCGCAAGGTGCCAGTGG
TCTACTCCGCCCCGGTTGTTCATGCTGCCCCAGTGGTACATGCCGCTCCT
CTGGTCAAGACTGTGATCCCTGCCGCTCCCCTGGTCAAGACTGTGATCCC
TGCCGCTCCCGTCCTTAAGACTGTGGTCTCCTCTGCTCCTCTGGTCCACA
CTGTCGTCCCAGCCGCTCCACTGGTCAAGACCGTCATCCCAGCTGCTCCG
GTTATCAAGACCGTGATCCCAGCTGCCCCTCTGGTTCACACCGTCCACAG
CGCCCCAGTTGTCTACTCCGCCTACCACAAGGCAAGCTTTCTAGACCAT
BO27460.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13059-RA | 468 | CG13059-PA | 1..465 | 17..481 | 2325 | 100 | Plus |
CG13059-RA | 468 | CG13059-PA | 225..380 | 271..426 | 285 | 78.8 | Plus |
CG13059-RA | 468 | CG13059-PA | 255..410 | 241..396 | 285 | 78.8 | Plus |
CG13059-RA | 468 | CG13059-PA | 229..339 | 335..445 | 225 | 80.2 | Plus |
CG13059-RA | 468 | CG13059-PA | 319..429 | 245..355 | 225 | 80.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13059-RA | 572 | CG13059-RA | 60..524 | 17..481 | 2325 | 100 | Plus |
CG13059-RA | 572 | CG13059-RA | 284..439 | 271..426 | 285 | 78.8 | Plus |
CG13059-RA | 572 | CG13059-RA | 314..469 | 241..396 | 285 | 78.8 | Plus |
CG13059-RA | 572 | CG13059-RA | 288..398 | 335..445 | 225 | 80.2 | Plus |
CG13059-RA | 572 | CG13059-RA | 378..488 | 245..355 | 225 | 80.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16323808..16324260 | 29..481 | 2265 | 100 | Plus |
3L | 28110227 | 3L | 16324020..16324175 | 271..426 | 285 | 78.8 | Plus |
3L | 28110227 | 3L | 16324050..16324205 | 241..396 | 285 | 78.8 | Plus |
3L | 28110227 | 3L | 16324024..16324134 | 335..445 | 225 | 80.2 | Plus |
3L | 28110227 | 3L | 16324114..16324224 | 245..355 | 225 | 80.2 | Plus |
Blast to na_te.dros performed 2014-11-28 02:41:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dnet\R1B | 2038 | Dnet\R1B NETR1B 2038bp | 1288..1328 | 269..230 | 121 | 80.5 | Minus |
BO27460.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:47 Download gff for
BO27460.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13059-RA | 6..465 | 22..483 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:41 Download gff for
BO27460.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13059-RA | 65..524 | 22..483 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:24 Download gff for
BO27460.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13059-RA | 65..524 | 22..483 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:24 Download gff for
BO27460.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16323803..16324260 | 22..483 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:41 Download gff for
BO27460.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16316903..16317360 | 22..483 | 98 | | Plus |
BO27460.pep Sequence
Translation from 16 to 499
> BO27460.pep
MFKFVAFFACLAVAAAAPGLIAETHSIVQPAILAKTAYVDTSASSAITHQ
SNVNLVRKVPVVYSAPVVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVL
KTVVSSAPLVHTVVPAAPLVKTVIPAAPVIKTVIPAAPLVHTVHSAPVVY
SAYHKASFLDH
BO27460.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:18:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13059-PA | 155 | CG13059-PA | 1..155 | 1..155 | 764 | 100 | Plus |
CG13040-PB | 185 | CG13040-PB | 1..151 | 1..161 | 242 | 38.9 | Plus |
CG13040-PA | 185 | CG13040-PA | 1..151 | 1..161 | 242 | 38.9 | Plus |
CG13060-PA | 131 | CG13060-PA | 1..131 | 1..154 | 213 | 42.9 | Plus |
CG13041-PA | 124 | CG13041-PA | 1..123 | 1..144 | 203 | 45.2 | Plus |