Clone BO27506 Report

Search the DGRC for BO27506

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG16713-RA
Protein status:BO27506.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO27506.complete Sequence

280 bp assembled on 2010-08-18

GenBank Submission: KX793751

> BO27506.complete
GAAGTTATCAGTCGACATGAAACTGTTGATTTTGGTTTTCGTGTTTGTCG
CTTTTGTGGCCAACGCCTTGGCCCTGAAAAATGCAATCTGTGGTCTACCC
CATTCCCTAAACGGAGATGGCAGAATATCCTGTGAGGCCTATATACCCAG
TTGGTCCTACGACGCCGATCGAAACGAGTGCGTCAAATTTATCTACGGAG
GCTGCGGAGGCAATAACAATAGATTTAATTCGAGGGAAATCTGTGAAGAC
AAGTGTTTGCAAGCAAGCTTTCTAGACCAT

BO27506.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-RA 249 CG16713-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-RA 325 CG16713-RA 56..301 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3695056..3695235 262..83 900 100 Minus
2L 23513712 2L 3695290..3695356 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:50:02 has no hits.

BO27506.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:18 Download gff for BO27506.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 51..296 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:33:48 Download gff for BO27506.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 56..301 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:32 Download gff for BO27506.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 56..301 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:32 Download gff for BO27506.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3695054..3695234 84..264 98 <- Minus
2L 3695290..3695356 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:33:48 Download gff for BO27506.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3695054..3695234 84..264 98 <- Minus
arm_2L 3695290..3695356 17..83 100   Minus

BO27506.pep Sequence

Translation from 16 to 280

> BO27506.pep
MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDA
DRNECVKFIYGGCGGNNNRFNSREICEDKCLQASFLDH

BO27506.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-PA 82 CG16713-PA 1..82 1..82 446 100 Plus
CG16712-PB 82 CG16712-PB 1..80 1..80 253 56.2 Plus
CG16712-PA 82 CG16712-PA 1..80 1..80 253 56.2 Plus
Acp24A4-PC 78 CG31779-PC 1..78 1..82 245 57.3 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..82 245 57.3 Plus