BO27507.complete Sequence
178 bp assembled on 2010-08-18
GenBank Submission: KX796599
> BO27507.complete
GAAGTTATCAGTCGACATGTGGTCGAAAATTGCCATCGCCGGAGCCCTGC
TCGTGATGGGTGGCGTCCTGTCCTCCAGCGTGGTGGACAACTTCGCCTAC
GTGGATCGCTCGCTGCCGGTGGCCATGCCCAAGGCAAAGGCCTTCCAAGT
GAAACAGGAGGCAAGCTTTCTAGACCAT
BO27507.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34330-RB | 147 | CG34330-PB | 1..144 | 17..160 | 720 | 100 | Plus |
CG34330-RA | 147 | CG34330-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34330-RB | 699 | CG34330-RB | 206..350 | 16..160 | 725 | 100 | Plus |
CG34330-RA | 618 | CG34330-RA | 125..269 | 16..160 | 725 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19068624..19068768 | 160..16 | 725 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:46:50 has no hits.
BO27507.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:10 Download gff for
BO27507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34330-RA | 126..269 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:45 Download gff for
BO27507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34330-RA | 126..269 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:12 Download gff for
BO27507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34330-RA | 126..269 | 17..162 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:12 Download gff for
BO27507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19068621..19068767 | 17..162 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:45 Download gff for
BO27507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 18962654..18962800 | 17..162 | 98 | | Minus |
BO27507.pep Sequence
Translation from 16 to 178
> BO27507.pep
MWSKIAIAGALLVMGGVLSSSVVDNFAYVDRSLPVAMPKAKAFQVKQEAS
FLDH
BO27507.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34330-PB | 48 | CG34330-PB | 1..48 | 1..48 | 235 | 100 | Plus |
CG34330-PA | 48 | CG34330-PA | 1..48 | 1..48 | 235 | 100 | Plus |