Clone BO27507 Report

Search the DGRC for BO27507

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG34330-RA
Protein status:BO27507.pep: Inserted from web
Sequenced Size:178

Clone Sequence Records

BO27507.complete Sequence

178 bp assembled on 2010-08-18

GenBank Submission: KX796599

> BO27507.complete
GAAGTTATCAGTCGACATGTGGTCGAAAATTGCCATCGCCGGAGCCCTGC
TCGTGATGGGTGGCGTCCTGTCCTCCAGCGTGGTGGACAACTTCGCCTAC
GTGGATCGCTCGCTGCCGGTGGCCATGCCCAAGGCAAAGGCCTTCCAAGT
GAAACAGGAGGCAAGCTTTCTAGACCAT

BO27507.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-RB 147 CG34330-PB 1..144 17..160 720 100 Plus
CG34330-RA 147 CG34330-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-RB 699 CG34330-RB 206..350 16..160 725 100 Plus
CG34330-RA 618 CG34330-RA 125..269 16..160 725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19068624..19068768 160..16 725 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:50 has no hits.

BO27507.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:10 Download gff for BO27507.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 126..269 17..162 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:45 Download gff for BO27507.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 126..269 17..162 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:12 Download gff for BO27507.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 126..269 17..162 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:12 Download gff for BO27507.complete
Subject Subject Range Query Range Percent Splice Strand
X 19068621..19068767 17..162 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:45 Download gff for BO27507.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18962654..18962800 17..162 98   Minus

BO27507.pep Sequence

Translation from 16 to 178

> BO27507.pep
MWSKIAIAGALLVMGGVLSSSVVDNFAYVDRSLPVAMPKAKAFQVKQEAS
FLDH

BO27507.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-PB 48 CG34330-PB 1..48 1..48 235 100 Plus
CG34330-PA 48 CG34330-PA 1..48 1..48 235 100 Plus