Clone BO27510 Report

Search the DGRC for BO27510

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG12158-RA
Protein status:BO27510.pep: Inserted from web
Sequenced Size:217

Clone Sequence Records

BO27510.complete Sequence

217 bp assembled on 2010-08-18

GenBank Submission: KX798619

> BO27510.complete
GAAGTTATCAGTCGACATGAAGCAGTTCGCATTGTTCAGCATCTTCCTTC
TAATTCTGGCTGTGGGTTTGGCACAAATGCCGCTGCAGGTGGCCGCCCAG
GGCCAAAATGGACATTCGCAGGGACAGCCGCCAAGACCGCCAAATGGCAA
TGGAAACGGCAACCAGCAGAGTGGACAAGGACAAAGCGGGCAGAACAACG
CAAGCTTTCTAGACCAT

BO27510.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-RA 186 CG12158-PA 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-RA 279 CG12158-RA 16..200 15..199 925 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9362653..9362782 199..70 650 100 Minus
2R 25286936 2R 9362835..9362891 71..15 285 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:56 has no hits.

BO27510.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:11 Download gff for BO27510.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 18..200 17..201 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:47 Download gff for BO27510.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 18..200 17..201 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:14 Download gff for BO27510.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 18..200 17..201 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:14 Download gff for BO27510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9362651..9362781 71..201 98 <- Minus
2R 9362836..9362889 17..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:47 Download gff for BO27510.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5250156..5250286 71..201 98 <- Minus
arm_2R 5250341..5250394 17..70 100   Minus

BO27510.pep Sequence

Translation from 16 to 217

> BO27510.pep
MKQFALFSIFLLILAVGLAQMPLQVAAQGQNGHSQGQPPRPPNGNGNGNQ
QSGQGQSGQNNASFLDH

BO27510.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-PA 61 CG12158-PA 1..61 1..61 319 100 Plus