BO27513.complete Sequence
214 bp assembled on 2010-08-18
GenBank Submission: KX798618
> BO27513.complete
GAAGTTATCAGTCGACATGGTGAGGAAGCACAAAGGAACACTGGCGGTGA
TCGAGAAGATCTACCAGGATATACCCGCATTCTCCGACATCTTCACCGAG
GAGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCCACCATTCTGGT
GGCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGTCGATTTCGCAA
GCTTTCTAGACCAT
BO27513.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33155-RD | 183 | CG33155-PD | 1..180 | 17..196 | 900 | 100 | Plus |
CG33155-RC | 183 | CG33155-PC | 1..180 | 17..196 | 900 | 100 | Plus |
CG33155-RA | 183 | CG33155-PA | 1..180 | 17..196 | 900 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33155-RD | 942 | CG33155-RD | 695..874 | 17..196 | 900 | 100 | Plus |
CG33155-RC | 829 | CG33155-RC | 582..761 | 17..196 | 900 | 100 | Plus |
CG33155-RA | 725 | CG33155-RA | 478..657 | 17..196 | 900 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13955417..13955596 | 17..196 | 900 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:46:44 has no hits.
BO27513.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:10 Download gff for
BO27513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33155-RC | 578..757 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:43 Download gff for
BO27513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33155-RA | 478..657 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:10 Download gff for
BO27513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33155-RA | 478..657 | 17..198 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:10 Download gff for
BO27513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13955417..13955596 | 17..198 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:43 Download gff for
BO27513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 9842922..9843101 | 17..198 | 98 | | Plus |
BO27513.pep Sequence
Translation from 16 to 214
> BO27513.pep
MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILS
RFITIKPVDFASFLDH
BO27513.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33155-PD | 60 | CG33155-PD | 1..60 | 1..60 | 308 | 100 | Plus |
CG33155-PC | 60 | CG33155-PC | 1..60 | 1..60 | 308 | 100 | Plus |
CG33155-PA | 60 | CG33155-PA | 1..60 | 1..60 | 308 | 100 | Plus |