Clone BO27513 Report

Search the DGRC for BO27513

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG33155-RA
Protein status:BO27513.pep: Inserted from web
Sequenced Size:214

Clone Sequence Records

BO27513.complete Sequence

214 bp assembled on 2010-08-18

GenBank Submission: KX798618

> BO27513.complete
GAAGTTATCAGTCGACATGGTGAGGAAGCACAAAGGAACACTGGCGGTGA
TCGAGAAGATCTACCAGGATATACCCGCATTCTCCGACATCTTCACCGAG
GAGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCCACCATTCTGGT
GGCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGTCGATTTCGCAA
GCTTTCTAGACCAT

BO27513.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-RD 183 CG33155-PD 1..180 17..196 900 100 Plus
CG33155-RC 183 CG33155-PC 1..180 17..196 900 100 Plus
CG33155-RA 183 CG33155-PA 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-RD 942 CG33155-RD 695..874 17..196 900 100 Plus
CG33155-RC 829 CG33155-RC 582..761 17..196 900 100 Plus
CG33155-RA 725 CG33155-RA 478..657 17..196 900 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13955417..13955596 17..196 900 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:44 has no hits.

BO27513.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:10 Download gff for BO27513.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RC 578..757 17..198 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:43 Download gff for BO27513.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RA 478..657 17..198 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:10 Download gff for BO27513.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RA 478..657 17..198 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:10 Download gff for BO27513.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13955417..13955596 17..198 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:43 Download gff for BO27513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9842922..9843101 17..198 98   Plus

BO27513.pep Sequence

Translation from 16 to 214

> BO27513.pep
MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILS
RFITIKPVDFASFLDH

BO27513.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-PD 60 CG33155-PD 1..60 1..60 308 100 Plus
CG33155-PC 60 CG33155-PC 1..60 1..60 308 100 Plus
CG33155-PA 60 CG33155-PA 1..60 1..60 308 100 Plus