Clone BO27538 Report

Search the DGRC for BO27538

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptSrp14-RB
Protein status:BO27538.pep: Imported from assembly
Sequenced Size:361

Clone Sequence Records

BO27538.complete Sequence

361 bp assembled on 2010-08-18

GenBank Submission: KX798250

> BO27538.complete
GAAGTTATCAGTCGACATGGTTTTGCTAGACAATTCGAACTTTATCCTGC
GCCTGGAGAAGATCGCAAATGCGGCCAAGAAGGACTCCTCCTTCACGCTG
ACGTTCAAGCGATATGATGGCAACGATAAGCCCGTGCCGAGGGAAGGACG
GCCACCGCTGCCCAAGCCGGAGACCTACATGTGCCTGATGCGCGCCCAGT
CCAAGTCCCAAAAAATTTCCACCGTTGTCCGGCAGGAGGATGTGCCCGCC
ATGATGAGCATGTACTCGCAGTTCATGAAGAGCAAGATGGACGGGCTAAA
GCGGGTTAAGAAAGTCAAAAGCAAGGCCAAGGCGACAAAGGGTGCAAGCT
TTCTAGACCAT

BO27538.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Srp14-RB 330 CG5417-PB 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Srp14-RB 464 CG5417-RB 51..381 13..343 1640 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20580553..20580681 215..343 645 100 Plus
3R 32079331 3R 20580390..20580490 114..214 505 100 Plus
3R 32079331 3R 20580249..20580325 41..117 370 98.7 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:48 has no hits.

BO27538.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:57:00 Download gff for BO27538.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 42..368 17..345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:20 Download gff for BO27538.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 55..381 17..345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:54 Download gff for BO27538.complete
Subject Subject Range Query Range Percent Splice Strand
Srp14-RB 55..381 17..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:54 Download gff for BO27538.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20580169..20580192 17..40 100 -> Plus
3R 20580249..20580321 41..113 100 -> Plus
3R 20580390..20580490 114..214 100 -> Plus
3R 20580553..20580681 215..345 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:20 Download gff for BO27538.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16405891..16405914 17..40 100 -> Plus
arm_3R 16405971..16406043 41..113 100 -> Plus
arm_3R 16406112..16406212 114..214 100 -> Plus
arm_3R 16406275..16406403 215..345 98   Plus

BO27538.pep Sequence

Translation from 16 to 361

> BO27538.pep
MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPK
PETYMCLMRAQSKSQKISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKV
KSKAKATKGASFLDH

BO27538.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Srp14-PB 109 CG5417-PB 1..109 1..109 552 100 Plus