Clone BO27552 Report

Search the DGRC for BO27552

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptZasp66-RH
Protein status:BO27552.pep: Imported from assembly
Sequenced Size:439

Clone Sequence Records

BO27552.complete Sequence

439 bp assembled on 2010-08-18

GenBank Submission: KX795190

> BO27552.complete
GAAGTTATCAGTCGACATGGAGTACGTTCAGTTCAAAAACGGATCCCCAG
TCTACTACAAGGAGCAGCCAGACCTCAATGAGTGCATTCAATACCAACCC
TACCGTACAACTCCGCTGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGC
GCCCACGACAGAGTCCTACTTGAGGCACTACCCCAACCCGGCTGTGCGCG
CCCACCCAGGACACGACTACCATGACAGTATCATGAAGCAGCGCGTGGCC
GACACCATGCTGCACAAGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGT
CTTCCACAAGCAATTCAACTCGCCCATTGGCCTGTACTCCAACAACAACA
TCGAGGACACCATCAGATCCACAGTTCCAAACCAGTATCAGCGCCAGTAT
CCCGGCCGCCGTACAATGTGGGCAAGCTTTCTAGACCAT

BO27552.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-RH 408 CG6416-PH 1..405 17..421 2025 100 Plus
Zasp66-RG 498 CG6416-PG 1..364 17..380 1820 100 Plus
Zasp66-RI 648 CG6416-PI 1..362 17..378 1810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-RH 1120 CG6416-RH 173..577 17..421 2025 100 Plus
Zasp66-RG 786 CG6416-RG 173..536 17..380 1820 100 Plus
Zasp66-RI 1280 CG6416-RI 173..534 17..378 1810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8634579..8634785 94..300 1020 99.5 Plus
3L 28110227 3L 8630555..8630635 17..97 405 100 Plus
3L 28110227 3L 8635002..8635081 299..378 400 100 Plus
3L 28110227 3L 8638157..8638198 379..420 210 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:26 has no hits.

BO27552.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:53 Download gff for BO27552.complete
Subject Subject Range Query Range Percent Splice Strand
CG6416-RH 167..571 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:12 Download gff for BO27552.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 173..577 17..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:48 Download gff for BO27552.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 173..577 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:48 Download gff for BO27552.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8630555..8630635 17..97 100 -> Plus
3L 8634583..8634783 98..298 100 -> Plus
3L 8635002..8635081 299..378 100 -> Plus
3L 8638157..8638200 379..423 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:12 Download gff for BO27552.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8623655..8623735 17..97 100 -> Plus
arm_3L 8627683..8627883 98..298 100 -> Plus
arm_3L 8628102..8628181 299..378 100 -> Plus
arm_3L 8631257..8631300 379..423 95   Plus

BO27552.pep Sequence

Translation from 16 to 439

> BO27552.pep
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPNQYQRQYPGRRTMWASFLDH

BO27552.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-PH 135 CG6416-PH 1..135 1..135 740 100 Plus
Zasp66-PI 215 CG6416-PI 1..133 1..133 664 93.2 Plus
Zasp66-PG 165 CG6416-PG 1..121 1..121 656 100 Plus
Zasp66-PA 239 CG6416-PA 1..121 1..121 656 100 Plus
Zasp66-PJ 239 CG6416-PJ 1..121 1..121 656 100 Plus