BO27552.complete Sequence
439 bp assembled on 2010-08-18
GenBank Submission: KX795190
> BO27552.complete
GAAGTTATCAGTCGACATGGAGTACGTTCAGTTCAAAAACGGATCCCCAG
TCTACTACAAGGAGCAGCCAGACCTCAATGAGTGCATTCAATACCAACCC
TACCGTACAACTCCGCTGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGC
GCCCACGACAGAGTCCTACTTGAGGCACTACCCCAACCCGGCTGTGCGCG
CCCACCCAGGACACGACTACCATGACAGTATCATGAAGCAGCGCGTGGCC
GACACCATGCTGCACAAGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGT
CTTCCACAAGCAATTCAACTCGCCCATTGGCCTGTACTCCAACAACAACA
TCGAGGACACCATCAGATCCACAGTTCCAAACCAGTATCAGCGCCAGTAT
CCCGGCCGCCGTACAATGTGGGCAAGCTTTCTAGACCAT
BO27552.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zasp66-RH | 408 | CG6416-PH | 1..405 | 17..421 | 2025 | 100 | Plus |
Zasp66-RG | 498 | CG6416-PG | 1..364 | 17..380 | 1820 | 100 | Plus |
Zasp66-RI | 648 | CG6416-PI | 1..362 | 17..378 | 1810 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zasp66-RH | 1120 | CG6416-RH | 173..577 | 17..421 | 2025 | 100 | Plus |
Zasp66-RG | 786 | CG6416-RG | 173..536 | 17..380 | 1820 | 100 | Plus |
Zasp66-RI | 1280 | CG6416-RI | 173..534 | 17..378 | 1810 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 8634579..8634785 | 94..300 | 1020 | 99.5 | Plus |
3L | 28110227 | 3L | 8630555..8630635 | 17..97 | 405 | 100 | Plus |
3L | 28110227 | 3L | 8635002..8635081 | 299..378 | 400 | 100 | Plus |
3L | 28110227 | 3L | 8638157..8638198 | 379..420 | 210 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:45:26 has no hits.
BO27552.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:53 Download gff for
BO27552.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6416-RH | 167..571 | 17..423 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:12 Download gff for
BO27552.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Zasp66-RH | 173..577 | 17..423 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:48 Download gff for
BO27552.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Zasp66-RH | 173..577 | 17..423 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:48 Download gff for
BO27552.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 8630555..8630635 | 17..97 | 100 | -> | Plus |
3L | 8634583..8634783 | 98..298 | 100 | -> | Plus |
3L | 8635002..8635081 | 299..378 | 100 | -> | Plus |
3L | 8638157..8638200 | 379..423 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:12 Download gff for
BO27552.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 8623655..8623735 | 17..97 | 100 | -> | Plus |
arm_3L | 8627683..8627883 | 98..298 | 100 | -> | Plus |
arm_3L | 8628102..8628181 | 299..378 | 100 | -> | Plus |
arm_3L | 8631257..8631300 | 379..423 | 95 | | Plus |
BO27552.pep Sequence
Translation from 16 to 439
> BO27552.pep
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPNQYQRQYPGRRTMWASFLDH
BO27552.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:27:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zasp66-PH | 135 | CG6416-PH | 1..135 | 1..135 | 740 | 100 | Plus |
Zasp66-PI | 215 | CG6416-PI | 1..133 | 1..133 | 664 | 93.2 | Plus |
Zasp66-PG | 165 | CG6416-PG | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PA | 239 | CG6416-PA | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 1..121 | 1..121 | 656 | 100 | Plus |