Clone BO27568 Report

Search the DGRC for BO27568

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG30269-RA
Protein status:BO27568.pep: Imported from assembly
Sequenced Size:466

Clone Sequence Records

BO27568.complete Sequence

466 bp assembled on 2010-08-18

GenBank Submission: KX798647

> BO27568.complete
GAAGTTATCAGTCGACATGGATTCCGTCTATCCAGCTGCACCCTTGGAGG
CGCCCAAGGGATCCGTCGAGCTGCAGGCGACACCCGAGCAACAACACCTT
CTGCCACCGGCTCCACCCAGTTACGACCAGGCCACAACCACTCCGGCTGA
AACCACGGGACCAGCTCCAGTTCCAGCGAGCACATCCACCACACAGCACA
CGGTCGTCGTGGTGCCCGGTTCACCGTACGGCCCGGAGCCCATGGACGTG
CAGTGCCCGTACTGCCACAATTACGCCCGGACACGGGTCTCCTTCAAGCC
CAACTCGCGCACCCATCTGATAGCCTTGATATTATGCCTGTTCCAGTTGT
ACTGCTGTGTGTGTCTGCCGTACTGCATTTCCAGTTGCATGAACACCAAT
CACTACTGTGGCATGTGCGATCGTTATTTGGGCACCTACGATCGCAAAGC
AAGCTTTCTAGACCAT

BO27568.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG30269-RB 435 CG30269-PB 1..432 17..448 2160 100 Plus
CG30269-RA 435 CG30269-PA 1..432 17..448 2160 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG30273-RB 1234 CG30273-RB 705..1137 16..448 2165 100 Plus
CG30269-RB 1234 CG30269-RB 705..1137 16..448 2165 100 Plus
CG30269-RA 577 CG30269-RA 48..480 16..448 2165 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22667986..22668317 16..347 1660 100 Plus
2R 25286936 2R 22668649..22668751 346..448 515 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:44:44 has no hits.

BO27568.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:44 Download gff for BO27568.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 46..477 17..450 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:57 Download gff for BO27568.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 49..480 17..450 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:31 Download gff for BO27568.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RA 49..480 17..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:31 Download gff for BO27568.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22668649..22668751 346..450 98   Plus
2R 22667987..22668315 17..345 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:57 Download gff for BO27568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18555492..18555820 17..345 100 -> Plus
arm_2R 18556154..18556256 346..450 98   Plus

BO27568.pep Sequence

Translation from 16 to 466

> BO27568.pep
MDSVYPAAPLEAPKGSVELQATPEQQHLLPPAPPSYDQATTTPAETTGPA
PVPASTSTTQHTVVVVPGSPYGPEPMDVQCPYCHNYARTRVSFKPNSRTH
LIALILCLFQLYCCVCLPYCISSCMNTNHYCGMCDRYLGTYDRKASFLDH

BO27568.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG30269-PB 144 CG30269-PB 1..144 1..144 805 100 Plus
CG30269-PA 144 CG30269-PA 1..144 1..144 805 100 Plus
CG30273-PB 128 CG30273-PB 11..126 23..142 286 42.9 Plus
CG13510-PC 129 CG13510-PC 7..128 33..142 254 41.8 Plus
CG13510-PB 129 CG13510-PB 7..128 33..142 254 41.8 Plus