Clone BO27586 Report

Search the DGRC for BO27586

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG18619-RD
Protein status:BO27586.pep: Imported from assembly
Sequenced Size:316

Clone Sequence Records

BO27586.complete Sequence

316 bp assembled on 2010-08-18

GenBank Submission: KX798764

> BO27586.complete
GAAGTTATCAGTCGACATGGCTGATATGGAGATACAGAGCAACAAAATGT
CAATAACGGAGGAAACACAAGTGCAGACGCGCAAGGAATGTGGAAAAAGG
GGACGAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGACATGAAAGC
CAAACTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGCGCGCAAGA
AGCTGCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGGAGAAGGCT
GTAGTTGCTTTGCGTACGGAACTGGAGCGCGTCGTTAATTCAATGGAAGC
AAGCTTTCTAGACCAT

BO27586.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RD 285 CG18619-PD 1..282 17..298 1410 100 Plus
CG18619-RC 282 CG18619-PC 1..279 17..298 1330 98.9 Plus
CG18619-RA 357 CG18619-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RD 634 CG18619-RD 84..365 17..298 1410 100 Plus
CG18619-RC 516 CG18619-RC 84..362 17..298 1330 98.9 Plus
CG18619-RA 512 CG18619-RA 84..347 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264762..10264889 157..284 640 100 Plus
2L 23513712 2L 10264548..10264633 73..158 430 100 Plus
2L 23513712 2L 10264208..10264264 17..73 285 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:39:03 has no hits.

BO27586.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:17 Download gff for BO27586.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 78..359 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:52 Download gff for BO27586.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 84..365 17..300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:46 Download gff for BO27586.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 84..365 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:46 Download gff for BO27586.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264208..10264264 17..73 100 -> Plus
2L 10264549..10264633 74..158 100 -> Plus
2L 10264764..10264889 159..284 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:52 Download gff for BO27586.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10264208..10264264 17..73 100 -> Plus
arm_2L 10264549..10264633 74..158 100 -> Plus
arm_2L 10264764..10264889 159..284 100 -> Plus

BO27586.pep Sequence

Translation from 16 to 316

> BO27586.pep
MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERS
RQSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSMEASFLDH

BO27586.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-PD 94 CG18619-PD 1..94 1..94 464 100 Plus
CG18619-PC 93 CG18619-PC 1..93 1..94 447 98.9 Plus
CG18619-PA 118 CG18619-PA 1..90 1..90 440 97.8 Plus
CG18619-PB 117 CG18619-PB 1..89 1..90 423 96.7 Plus