Clone BO27726 Report

Search the DGRC for BO27726

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptTpnC73F-RA
Protein status:BO27726.pep: Imported from assembly
Sequenced Size:499

Clone Sequence Records

BO27726.complete Sequence

499 bp assembled on 2010-08-18

GenBank Submission: KX795492

> BO27726.complete
GAAGTTATCAGTCGACATGAGCAGCGTCGATGAAGATCTTACACCCGAGC
AGATCGCCGTGCTCCAGAAGGCGTTCAACAGCTTCGATCACCAGAAGACT
GGCTCCATCCCCACCGAGATGGTCGCCGACATACTGCGCCTGATGGGTCA
GCCCTTCGACAAGAAGATCCTGGAGGAACTGATCGAGGAGGTCGATGAGG
ACAAGTCCGGTCGCTTGGAATTCGGCGAGTTCGTCCAGCTGGCTGCCAAG
TTCATCGTGGAGGAGGATGCGGAGGCCATGCAGAAGGAGCTGCGCGAGGC
GTTCCGTTTGTACGATAAGCAGGGCAATGGCTTCATTCCCACCACCTGCC
TGAAGGAGATCCTCAAGGAGCTGGACGACCAGCTGACCGAACAGGAGCTG
GACATTATGATCGAGGAGATCGATTCCGATGGCTCCGGTACAGTGGATTT
CGATGAATTCATGGAGATGATGACTGGCGAGGCAAGCTTTCTAGACCAT

BO27726.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC73F-RC 468 CG7930-PC 1..465 17..481 2325 100 Plus
TpnC73F-RA 468 CG7930-PA 1..465 17..481 2325 100 Plus
TpnC47D-RB 468 CG9073-PB 16..465 32..481 1515 89.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC73F-RC 1059 CG7930-RC 193..659 15..481 2335 100 Plus
TpnC73F-RA 962 CG7930-RA 96..562 15..481 2335 100 Plus
TpnC47D-RB 791 CG9073-RB 70..519 32..481 1515 89.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17047350..17047601 204..455 1260 100 Plus
2R 25286936 2R 11274580..11274829 455..206 905 90.8 Minus
3L 28110227 3L 17046341..17046460 29..148 600 100 Plus
2R 25286936 2R 11274890..11275061 203..32 485 85.5 Minus
3L 28110227 3L 17046522..17046579 146..203 290 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:37:36 has no hits.

BO27726.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:59 Download gff for BO27726.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC73F-RA 94..558 17..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:25 Download gff for BO27726.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC73F-RA 98..562 17..483 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:16 Download gff for BO27726.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC73F-RA 98..562 17..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:16 Download gff for BO27726.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17046523..17046579 147..203 100 -> Plus
3L 17046341..17046458 29..146 100 -> Plus
3L 17047350..17047601 204..455 100 -> Plus
3L 17047965..17047990 456..483 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:25 Download gff for BO27726.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17039441..17039558 29..146 100 -> Plus
arm_3L 17039623..17039679 147..203 100 -> Plus
arm_3L 17040450..17040701 204..455 100 -> Plus
arm_3L 17041065..17041090 456..483 92   Plus

BO27726.pep Sequence

Translation from 16 to 499

> BO27726.pep
MSSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKK
ILEELIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYD
KQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFME
MMTGEASFLDH

BO27726.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC73F-PC 155 CG7930-PC 1..155 1..155 781 100 Plus
TpnC73F-PA 155 CG7930-PA 1..155 1..155 781 100 Plus
TpnC47D-PB 155 CG9073-PB 1..155 1..155 739 92.9 Plus
TpnC47D-PA 155 CG9073-PA 1..155 1..155 739 92.9 Plus
TpnC41C-PB 154 CG2981-PB 1..151 4..154 494 63.6 Plus