Clone BO27736 Report

Search the DGRC for BO27736

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG9065-RA
Protein status:BO27736.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO27736.complete Sequence

298 bp assembled on 2010-08-18

GenBank Submission: KX795854

> BO27736.complete
GAAGTTATCAGTCGACATGGGCAACAGTGCATCTCAAGGAGTTGCAGCTC
CAAGTGTTTCGGCGGCCCACCCGTTGACCACCGCATCCGCAGCCACCGCA
TCCACAACCACCGCATCCGCAGCCACCGCATCCGGCGAGAAGCCCAAGTG
CAAGGCCTGTTGCGCCTGCCCGGAGACCAAGAGGGCACGTGACGCCTGCA
TTGTGGAGAACGGCGAGGAGAATTGCTTGGCGCTGATAGAGGCGCACAAG
AAGTGCATGCGCGATGCCGGCTTCAATATCGCAAGCTTTCTAGACCAT

BO27736.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-RA 267 CG9065-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-RA 521 CG9065-RA 103..366 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15084353..15084534 198..17 910 100 Minus
X 23542271 X 15084184..15084266 280..198 415 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:36:50 has no hits.

BO27736.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:48 Download gff for BO27736.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 59..322 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:05 Download gff for BO27736.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 103..366 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:14:57 Download gff for BO27736.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 103..366 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:14:57 Download gff for BO27736.complete
Subject Subject Range Query Range Percent Splice Strand
X 15084182..15084265 199..282 97 <- Minus
X 15084353..15084534 17..198 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:05 Download gff for BO27736.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14978215..14978298 199..282 97 <- Minus
arm_X 14978386..14978567 17..198 100   Minus

BO27736.pep Sequence

Translation from 16 to 298

> BO27736.pep
MGNSASQGVAAPSVSAAHPLTTASAATASTTTASAATASGEKPKCKACCA
CPETKRARDACIVENGEENCLALIEAHKKCMRDAGFNIASFLDH

BO27736.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-PA 88 CG9065-PA 1..88 1..88 457 100 Plus