Clone BO27770 Report

Search the DGRC for BO27770

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG13877-RC
Protein status:BO27770.pep: full length peptide match
Sequenced Size:355

Clone Sequence Records

BO27770.complete Sequence

355 bp assembled on 2010-08-18

GenBank Submission: KX796772

> BO27770.complete
GAAGTTATCAGTCGACATGGTTTACATATGCACTCTTGTGGTGTTGATCT
TTCCCGTCTTGTTGTTGGGTGCACCATGGGAAGGGTCGCATCCTAAGTCT
CAGGTGGAATACATCAGCAACGACAAGAGAGTTGATTCTGGCTTCGCCAA
CCCCAATATCGTGCCCATCACCCAGCCGTCGGTCGTAACGCAAACAGCTC
CTCCTCCGCCGCCAAATTCCAAAAACTTTGCATATAGTCCGATGACGCAG
AGCTGGACCCTCATTGCGCCAGGCGATCCGCTGCCCAATAATGACACCCT
CGTCTGGAACCAGAGCAATGACAAATGGCTCACTCGCGCAAGCTTTCTAG
ACCAT

BO27770.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-RC 324 CG13877-PC 1..321 17..337 1605 100 Plus
CG13877-RB 327 CG13877-PB 1..324 17..337 1540 99.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-RC 416 CG13877-RC 20..340 17..337 1605 100 Plus
CG13877-RB 507 CG13877-RB 113..436 17..337 1540 99.1 Plus
pyx-RB 2502 CG17142-RB 1947..2251 337..33 1525 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 218283..218587 33..337 1525 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:37:59 has no hits.

BO27770.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:03 Download gff for BO27770.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RA 114..434 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:33 Download gff for BO27770.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 20..340 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:25 Download gff for BO27770.complete
Subject Subject Range Query Range Percent Splice Strand
CG13877-RC 20..340 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:25 Download gff for BO27770.complete
Subject Subject Range Query Range Percent Splice Strand
3L 218180..218195 17..32 100 -> Plus
3L 218283..218587 33..339 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:33 Download gff for BO27770.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 218180..218195 17..32 100 -> Plus
arm_3L 218283..218587 33..339 99   Plus

BO27770.pep Sequence

Translation from 16 to 355

> BO27770.pep
MVYICTLVVLIFPVLLLGAPWEGSHPKSQVEYISNDKRVDSGFANPNIVP
ITQPSVVTQTAPPPPPNSKNFAYSPMTQSWTLIAPGDPLPNNDTLVWNQS
NDKWLTRASFLDH

BO27770.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13877-PC 107 CG13877-PC 1..107 1..107 584 100 Plus
CG13877-PB 108 CG13877-PB 1..108 1..107 572 99.1 Plus