Clone BO27773 Report

Search the DGRC for BO27773

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptMgstl-RA
Protein status:BO27773.pep: full length peptide match
Sequenced Size:490

Clone Sequence Records

BO27773.complete Sequence

490 bp assembled on 2010-08-18

GenBank Submission: KX798120

> BO27773.complete
GAAGTTATCAGTCGACATGGCCAGCCCCGTGGAACTGCTAAGCCTCTCCA
ATCCCGTCTTCAAGAGTTTCACCTTTTGGGTCGGAGTTTTGGTGATCAAA
ATGCTGCTGATGAGCCTTCTGACAGCCATCCAGCGTTTCAAGACGAAGAC
CTTCGCCAACCCCGAGGACCTGATGTCCCCCAAGCTGAAGGTCAAGTTCG
ACGATCCGAACGTGGAGCGTGTGCGCCGTGCCCACCGCAACGACCTGGAG
AACATCCTGCCCTTCTTCGCCATCGGTCTGCTCTACGTCCTGACTGATCC
GGCCGCCTTTCTGGCCATCAACCTGTTCCGCGCCGTGGGCATCGCCCGCA
TCGTCCACACACTGGTCTACGCCGTGGTCGTGGTGCCCCAGCCTTCCCGT
GCCCTCGCCTTCTTCGTGGCCTTGGGCGCCACCGTCTACATGGCCCTGCA
GGTCATCGCCTCGGCCGCCTTCGCAAGCTTTCTAGACCAT

BO27773.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-RA 459 CG1742-PA 1..456 17..472 2280 100 Plus
Mgstl-RC 456 CG1742-PC 130..453 149..472 1620 100 Plus
Mgstl-RB 456 CG1742-PB 130..453 149..472 1620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-RA 660 CG1742-RA 101..556 17..472 2280 100 Plus
Mgstl-RC 951 CG1742-RC 524..847 149..472 1620 100 Plus
Mgstl-RB 591 CG1742-RB 164..487 149..472 1620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22226213..22226668 17..472 2040 96.5 Plus
X 23542271 X 21043678..21044003 147..472 1630 100 Plus
X 23542271 X 21043170..21043301 17..148 660 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:38:11 has no hits.

BO27773.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:06 Download gff for BO27773.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 99..554 17..474 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:37 Download gff for BO27773.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 101..556 17..474 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:28 Download gff for BO27773.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 101..556 17..474 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:28 Download gff for BO27773.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226213..22226668 17..474 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:37 Download gff for BO27773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22226213..22226668 17..474 96   Plus

BO27773.pep Sequence

Translation from 16 to 490

> BO27773.pep
MASPVELLSLSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPE
DLMSPKLKVKFDDPNVERVRRAHRNDLENILPFFAIGLLYVLTDPAAFLA
INLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVALGATVYMALQVIASA
AFASFLDH

BO27773.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PA 152 CG1742-PA 1..152 1..152 749 100 Plus
Mgstl-PC 151 CG1742-PC 5..151 6..152 614 83 Plus
Mgstl-PB 151 CG1742-PB 5..151 6..152 614 83 Plus
CG33178-PC 165 CG33178-PC 12..157 1..146 446 61 Plus
CG33178-PA 165 CG33178-PA 12..157 1..146 446 61 Plus