Clone BO27947 Report

Search the DGRC for BO27947

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptRpS28a-RA
Protein status:BO27947.pep: Imported from assembly
Sequenced Size:226

Clone Sequence Records

BO27947.complete Sequence

226 bp assembled on 2011-06-17

GenBank Submission: KX795349

> BO27947.complete
GAAGTTATCAGTCGACATGGACAAGCCTCAGTACGCTCGCGTGGTCGAGA
TCCTTGGACGCACTGGATCCCAAGGGCAGTGCACCCAGGTGCGGGTGGAG
TTCCTCGGCGACCAAAGCCGCCAGATTATTCGGAATGTCAAAGGACCTGT
TCGCGTGGGCGACATCCTGTCGCTGCTGGAAACTGAACGCGAGGCCAGGA
GACTGCGCGCAAGCTTTCTAGACCAT

BO27947.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28a-RA 195 CG15527-PA 1..192 17..208 960 100 Plus
RpS28b-RB 198 CG2998-PB 46..195 59..208 330 81.3 Plus
RpS28b-RA 198 CG2998-PA 46..195 59..208 330 81.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28a-RA 304 CG15527-RA 50..242 16..208 965 100 Plus
RpS28b-RB 972 CG2998-RB 133..282 59..208 330 81.3 Plus
RpS28b-RA 520 CG2998-RA 133..282 59..208 330 81.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30022407..30022599 208..16 965 100 Minus
X 23542271 X 9554755..9554904 59..208 330 81.3 Plus
Blast to na_te.dros performed on 2014-11-26 15:03:06 has no hits.

BO27947.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:08 Download gff for BO27947.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 1..192 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:20 Download gff for BO27947.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 51..242 17..210 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:25 Download gff for BO27947.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28a-RA 51..242 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:25 Download gff for BO27947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30022404..30022598 17..210 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:20 Download gff for BO27947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25848126..25848320 17..210 98   Minus

BO27947.pep Sequence

Translation from 16 to 226

> BO27947.pep
MDKPQYARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDI
LSLLETEREARRLRASFLDH

BO27947.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28a-PA 64 CG15527-PA 1..64 1..64 319 100 Plus
RpS28b-PB 65 CG2998-PB 1..65 1..64 264 81.5 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..64 264 81.5 Plus
RpS28-like-PA 76 CG34182-PA 9..74 7..69 129 42.4 Plus