BO27947.complete Sequence
226 bp assembled on 2011-06-17
GenBank Submission: KX795349
> BO27947.complete
GAAGTTATCAGTCGACATGGACAAGCCTCAGTACGCTCGCGTGGTCGAGA
TCCTTGGACGCACTGGATCCCAAGGGCAGTGCACCCAGGTGCGGGTGGAG
TTCCTCGGCGACCAAAGCCGCCAGATTATTCGGAATGTCAAAGGACCTGT
TCGCGTGGGCGACATCCTGTCGCTGCTGGAAACTGAACGCGAGGCCAGGA
GACTGCGCGCAAGCTTTCTAGACCAT
BO27947.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28a-RA | 195 | CG15527-PA | 1..192 | 17..208 | 960 | 100 | Plus |
RpS28b-RB | 198 | CG2998-PB | 46..195 | 59..208 | 330 | 81.3 | Plus |
RpS28b-RA | 198 | CG2998-PA | 46..195 | 59..208 | 330 | 81.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28a-RA | 304 | CG15527-RA | 50..242 | 16..208 | 965 | 100 | Plus |
RpS28b-RB | 972 | CG2998-RB | 133..282 | 59..208 | 330 | 81.3 | Plus |
RpS28b-RA | 520 | CG2998-RA | 133..282 | 59..208 | 330 | 81.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 30022407..30022599 | 208..16 | 965 | 100 | Minus |
X | 23542271 | X | 9554755..9554904 | 59..208 | 330 | 81.3 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:03:06 has no hits.
BO27947.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:08 Download gff for
BO27947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28a-RA | 1..192 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:20 Download gff for
BO27947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28a-RA | 51..242 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:25 Download gff for
BO27947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28a-RA | 51..242 | 17..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:25 Download gff for
BO27947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30022404..30022598 | 17..210 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:20 Download gff for
BO27947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25848126..25848320 | 17..210 | 98 | | Minus |
BO27947.pep Sequence
Translation from 16 to 226
> BO27947.pep
MDKPQYARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDI
LSLLETEREARRLRASFLDH
BO27947.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:27:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28a-PA | 64 | CG15527-PA | 1..64 | 1..64 | 319 | 100 | Plus |
RpS28b-PB | 65 | CG2998-PB | 1..65 | 1..64 | 264 | 81.5 | Plus |
RpS28b-PA | 65 | CG2998-PA | 1..65 | 1..64 | 264 | 81.5 | Plus |
RpS28-like-PA | 76 | CG34182-PA | 9..74 | 7..69 | 129 | 42.4 | Plus |