Clone BO27950 Report

Search the DGRC for BO27950

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptBrd-RA
Protein status:BO27950.pep: Inserted from web
Sequenced Size:277

Clone Sequence Records

BO27950.complete Sequence

277 bp assembled on 2011-06-17

GenBank Submission: KX798082

> BO27950.complete
GAAGTTATCAGTCGACATGGCCTACGAAACTCTGATGAACACCACCATCT
ACACCACCACTCCTGTCTGCCAGAAGAAGACCTACACACCCGCCAAGGCC
ATGAAGAAGATCTTCAAGGTGGCCTGCAAAATCTTCAAGGCATCGGGCCA
CCAGCAACTGAAGAACCACTCCATGCCGAAGGAGCTCCCACTGCCCACTT
CCGAGGAGGAGCTGCAGAACTCCCAGAACGAGCAATTGGAAGCCGAGCTC
GTCCAACTGGCAAGCTTTCTAGACCAT

BO27950.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Brd-RA 246 CG3096-PA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Brd-RA 532 CG3096-RA 73..315 17..259 1215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14972739..14972981 17..259 1215 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:49:16 has no hits.

BO27950.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:31 Download gff for BO27950.complete
Subject Subject Range Query Range Percent Splice Strand
Brd-RA 71..313 17..261 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:43:23 Download gff for BO27950.complete
Subject Subject Range Query Range Percent Splice Strand
Brd-RA 73..315 17..261 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:52 Download gff for BO27950.complete
Subject Subject Range Query Range Percent Splice Strand
Brd-RA 73..315 17..261 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:52 Download gff for BO27950.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14972739..14972981 17..261 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:43:23 Download gff for BO27950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14965839..14966081 17..261 99   Plus

BO27950.pep Sequence

Translation from 16 to 277

> BO27950.pep
MAYETLMNTTIYTTTPVCQKKTYTPAKAMKKIFKVACKIFKASGHQQLKN
HSMPKELPLPTSEEELQNSQNEQLEAELVQLASFLDH

BO27950.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24625-PA 80 GF24625-PA 1..80 1..81 261 71.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15704-PA 72 GG15704-PA 1..72 1..81 307 80.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Brd-PA 81 CG3096-PA 1..81 1..81 418 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24653-PA 94 GL24653-PA 1..94 1..81 214 55.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15923-PA 94 GA15923-PA 1..94 1..81 207 55.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25491-PA 80 GM25491-PA 1..80 1..81 386 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14511-PA 81 GD14511-PA 1..81 1..81 374 93.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22036-PA 76 GE22036-PA 1..76 1..81 310 81.5 Plus