BO27968.complete Sequence
199 bp assembled on 2011-06-17
GenBank Submission: KX798016
> BO27968.complete
GAAGTTATCAGTCGACATGAAGTTACTGAACCTACTACTGGTCGTTCTCT
TCCTAATAGGAATGGTTGAGGCTCGAAGAAGGAAAAGAGAGGTTGAAATT
TGGATACGACCAGAAAAGCACAATCCACCAGGAACCAGATATTGTTCACC
TGAGGACCCCATGTGTCAAAGATATGGTGATGCAAGCTTTCTAGACCAT
BO27968.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:51:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp70A4-RB | 168 | CG42480-PB | 1..165 | 17..181 | 825 | 100 | Plus |
Sfp70A4-RA | 168 | CG42480-PA | 1..165 | 17..181 | 825 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:51:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp70A4-RB | 331 | CG42480-RB | 5..169 | 17..181 | 825 | 100 | Plus |
Sfp70A4-RA | 205 | CG42480-RA | 5..169 | 17..181 | 825 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:51:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13296692..13296856 | 181..17 | 825 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:51:06 has no hits.
BO27968.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:41 Download gff for
BO27968.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..169 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:44:05 Download gff for
BO27968.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..169 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:27 Download gff for
BO27968.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp70A4-RA | 5..169 | 17..183 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:27 Download gff for
BO27968.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13296690..13296856 | 17..183 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:05 Download gff for
BO27968.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13289790..13289956 | 17..183 | 98 | | Minus |
BO27968.pep Sequence
Translation from 16 to 199
> BO27968.pep
MKLLNLLLVVLFLIGMVEARRRKREVEIWIRPEKHNPPGTRYCSPEDPMC
QRYGDASFLDH
BO27968.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp70A4-PB | 55 | CG42480-PB | 1..55 | 1..55 | 298 | 100 | Plus |
Sfp70A4-PA | 55 | CG42480-PA | 1..55 | 1..55 | 298 | 100 | Plus |