Clone BO27968 Report

Search the DGRC for BO27968

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptSfp70A4-RA
Protein status:BO27968.pep: Imported from assembly
Sequenced Size:199

Clone Sequence Records

BO27968.complete Sequence

199 bp assembled on 2011-06-17

GenBank Submission: KX798016

> BO27968.complete
GAAGTTATCAGTCGACATGAAGTTACTGAACCTACTACTGGTCGTTCTCT
TCCTAATAGGAATGGTTGAGGCTCGAAGAAGGAAAAGAGAGGTTGAAATT
TGGATACGACCAGAAAAGCACAATCCACCAGGAACCAGATATTGTTCACC
TGAGGACCCCATGTGTCAAAGATATGGTGATGCAAGCTTTCTAGACCAT

BO27968.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp70A4-RB 168 CG42480-PB 1..165 17..181 825 100 Plus
Sfp70A4-RA 168 CG42480-PA 1..165 17..181 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp70A4-RB 331 CG42480-RB 5..169 17..181 825 100 Plus
Sfp70A4-RA 205 CG42480-RA 5..169 17..181 825 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13296692..13296856 181..17 825 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:51:06 has no hits.

BO27968.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:52:41 Download gff for BO27968.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..169 17..183 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:44:05 Download gff for BO27968.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..169 17..183 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:27 Download gff for BO27968.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp70A4-RA 5..169 17..183 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:27 Download gff for BO27968.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13296690..13296856 17..183 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:05 Download gff for BO27968.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13289790..13289956 17..183 98   Minus

BO27968.pep Sequence

Translation from 16 to 199

> BO27968.pep
MKLLNLLLVVLFLIGMVEARRRKREVEIWIRPEKHNPPGTRYCSPEDPMC
QRYGDASFLDH

BO27968.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp70A4-PB 55 CG42480-PB 1..55 1..55 298 100 Plus
Sfp70A4-PA 55 CG42480-PA 1..55 1..55 298 100 Plus