Clone BO27975 Report

Search the DGRC for BO27975

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptLcp65Ae-RA
Protein status:BO27975.pep: Imported from assembly
Sequenced Size:331

Clone Sequence Records

BO27975.complete Sequence

331 bp assembled on 2011-06-17

GenBank Submission: KX799842

> BO27975.complete
GAAGTTATCAGTCGACATGAAATTCCTGATCGTCTTTGTAGCAATCTTCG
CTTTTGCTTTGGCTAACGAAGCGCAAATTATTAACTTGGAATCCGATGTT
GGACCCGAAAACTTTCAGTGGTCCTTCGAGACCAGCGATGGCCAGGCGGC
TAACGCTAAGGGACAGTTGAAGTACCCTAACACCGACCACGAGTCCCTTG
CTGTCCAGGGATCCTTCCGCTTCGTTGCCGATGATGGCCAGACCTACGAA
GTCAACTACATCGCCGATGAGAACGGATTCCAGCCCCAGGGTGCCCATCT
TCCCGTTGCCTCCGCAAGCTTTCTAGACCAT

BO27975.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ae-RA 300 CG10529-PA 1..297 17..313 1485 100 Plus
Lcp65Ag1-RA 318 CG10530-PA 205..310 209..314 410 92.5 Plus
Lcp65Ag2-RA 318 CG10534-PA 205..310 209..314 410 92.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ae-RA 476 CG10529-RA 39..337 15..313 1495 100 Plus
Lcp65Ag1-RA 517 CG10530-RA 266..371 209..314 410 92.5 Plus
Lcp65Ag2-RA 543 CG10534-RA 266..371 209..314 410 92.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6137722..6137911 313..124 950 100 Minus
3L 28110227 3L 6137972..6138080 123..15 545 100 Minus
3L 28110227 3L 6133162..6133267 314..209 410 92.5 Minus
3L 28110227 3L 6134843..6134948 314..209 410 92.5 Minus
3L 28110227 3L 6130559..6130664 314..209 395 91.5 Minus
3L 28110227 3L 6145166..6145289 181..304 320 83.9 Plus
3L 28110227 3L 6147571..6147680 314..205 295 84.5 Minus
3L 28110227 3L 6150442..6150551 314..205 295 84.5 Minus
3L 28110227 3L 6136388..6136482 314..220 265 85.3 Minus
Blast to na_te.dros performed on 2014-11-26 15:00:53 has no hits.

BO27975.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:03 Download gff for BO27975.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ae-RA 1..297 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:52 Download gff for BO27975.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ae-RA 41..337 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:42 Download gff for BO27975.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ae-RA 41..337 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:42 Download gff for BO27975.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6137720..6137911 124..315 98 <- Minus
3L 6137972..6138078 17..123 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:52 Download gff for BO27975.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6131072..6131178 17..123 100   Minus
arm_3L 6130820..6131011 124..315 98 <- Minus

BO27975.pep Sequence

Translation from 16 to 331

> BO27975.pep
MKFLIVFVAIFAFALANEAQIINLESDVGPENFQWSFETSDGQAANAKGQ
LKYPNTDHESLAVQGSFRFVADDGQTYEVNYIADENGFQPQGAHLPVASA
SFLDH

BO27975.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ae-PA 99 CG10529-PA 1..99 1..99 513 100 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..102 1..98 349 67.6 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..102 1..98 349 67.6 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..102 1..98 346 66.7 Plus
Lcp65Af-PA 100 CG10533-PA 1..97 1..98 327 65.3 Plus