Clone BO27988 Report

Search the DGRC for BO27988

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptIM14-RA
Protein status:BO27988.pep: Imported from assembly
Sequenced Size:172

Clone Sequence Records

BO27988.complete Sequence

172 bp assembled on 2011-06-21

GenBank Submission: KX797649

> BO27988.complete
GAAGTTATCAGTCGACATGAACTGTCTGAAGATCTGCGGCTTTTTCTTCG
CTCTGATTGCGGCTTTGGCGACGGCGGAGGCTGGCACCCAAGTCATTCAT
GCTGGCGGACACACGTTGATTCAAACTGATCGCTCGCAGTATATACGCAA
AAACGCAAGCTTTCTAGACCAT

BO27988.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-RA 141 CG33990-PA 1..138 17..154 690 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-RA 223 CG33990-RA 32..171 15..154 700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20870555..20870626 83..154 360 100 Plus
2R 25286936 2R 20870423..20870492 15..84 350 100 Plus
Blast to na_te.dros performed 2014-11-26 15:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 2485..2518 138..171 98 76.5 Plus

BO27988.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:36 Download gff for BO27988.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 1..138 17..156 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:30 Download gff for BO27988.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 34..171 17..156 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:19 Download gff for BO27988.complete
Subject Subject Range Query Range Percent Splice Strand
IM14-RA 34..171 17..156 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:19 Download gff for BO27988.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20870425..20870491 17..83 100 -> Plus
2R 20870556..20870626 84..156 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:30 Download gff for BO27988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16757930..16757996 17..83 100 -> Plus
arm_2R 16758061..16758131 84..156 97   Plus

BO27988.pep Sequence

Translation from 16 to 172

> BO27988.pep
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKNASFL
DH

BO27988.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
IM14-PA 46 CG33990-PA 1..46 1..46 238 100 Plus