BO27988.complete Sequence
172 bp assembled on 2011-06-21
GenBank Submission: KX797649
> BO27988.complete
GAAGTTATCAGTCGACATGAACTGTCTGAAGATCTGCGGCTTTTTCTTCG
CTCTGATTGCGGCTTTGGCGACGGCGGAGGCTGGCACCCAAGTCATTCAT
GCTGGCGGACACACGTTGATTCAAACTGATCGCTCGCAGTATATACGCAA
AAACGCAAGCTTTCTAGACCAT
BO27988.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-RA | 141 | CG33990-PA | 1..138 | 17..154 | 690 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-RA | 223 | CG33990-RA | 32..171 | 15..154 | 700 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20870555..20870626 | 83..154 | 360 | 100 | Plus |
2R | 25286936 | 2R | 20870423..20870492 | 15..84 | 350 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:11:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
I-element | 5371 | I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). | 2485..2518 | 138..171 | 98 | 76.5 | Plus |
BO27988.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:36 Download gff for
BO27988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 1..138 | 17..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:30 Download gff for
BO27988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 34..171 | 17..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:19 Download gff for
BO27988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM14-RA | 34..171 | 17..156 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:19 Download gff for
BO27988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20870425..20870491 | 17..83 | 100 | -> | Plus |
2R | 20870556..20870626 | 84..156 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:30 Download gff for
BO27988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16757930..16757996 | 17..83 | 100 | -> | Plus |
arm_2R | 16758061..16758131 | 84..156 | 97 | | Plus |
BO27988.pep Sequence
Translation from 16 to 172
> BO27988.pep
MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKNASFL
DH
BO27988.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM14-PA | 46 | CG33990-PA | 1..46 | 1..46 | 238 | 100 | Plus |