Clone BO27991 Report

Search the DGRC for BO27991

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptDup99B-RA
Protein status:BO27991.pep: Imported from assembly
Sequenced Size:196

Clone Sequence Records

BO27991.complete Sequence

196 bp assembled on 2011-06-21

GenBank Submission: KX799899

> BO27991.complete
GAAGTTATCAGTCGACATGAAGACTCCGCTATTTCTCCTCTTGGTCGTAT
TGGCTTCCCTCCTGGGATTGGCCTTATCCCAGGATCGAAATGATACGGAG
TGGATCCAAAGTCAGAAGGATCGTGAGAAGTGGTGCCGGCTAAACTTAGG
ACCCTACCTCGGTGGCAGATGCCGAAAAGCAAGCTTTCTAGACCAT

BO27991.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-RA 165 CG33495-PA 1..162 17..178 810 100 Plus
Dup99B-RB 114 CG33495-PB 1..111 17..127 555 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-RA 257 CG33495-RA 28..190 16..178 815 100 Plus
Dup99B-RB 310 CG33495-RB 28..143 16..131 565 99.1 Plus
Dup99B-RB 310 CG33495-RB 188..243 123..178 280 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29715235..29715350 131..16 565 99.1 Minus
3R 32079331 3R 29715135..29715190 178..123 280 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:13:22 has no hits.

BO27991.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:21 Download gff for BO27991.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..186 17..174 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:54 Download gff for BO27991.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..186 17..174 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:56 Download gff for BO27991.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..186 17..174 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:56 Download gff for BO27991.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29715139..29715190 123..174 100 <- Minus
3R 29715244..29715349 17..122 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:54 Download gff for BO27991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25540861..25540912 123..174 100 <- Minus
arm_3R 25540966..25541071 17..122 100   Minus

BO27991.pep Sequence

Translation from 16 to 196

> BO27991.pep
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRKASFLDH

BO27991.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-PA 54 CG33495-PA 1..54 1..54 286 100 Plus
Dup99B-PB 37 CG33495-PB 1..37 1..37 182 100 Plus