Clone BO27995 Report

Search the DGRC for BO27995

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCpr65Ax1-RA
Protein status:BO27995.pep: Imported from assembly
Sequenced Size:340

Clone Sequence Records

BO27995.complete Sequence

340 bp assembled on 2011-06-17

GenBank Submission: KX798975

> BO27995.complete
GAAGTTATCAGTCGACATGAAATTCGCCATCGTCCTGTTCGCCCTCTTTG
CCGTGGCCCTGGCTGCCCCTACTGTCGAGGTCCTGCGATCGGATAGCAAT
GTTGGAATCGATAACTACTCATATGCAGTTGAAACCAGCGACGGTACCTC
GAAGAGCGAGGAGGGTGTGCTGAAGAACGCCGGCACCGAGCTAGAGGCCA
TCTCAACCCACGGCTCCTTCAGCTACGTGGGCCCTGATGGCCAGACCTAC
ACCGTCACCTACGTGGCCGATGAGAACGGATTCCAGCCCCAGGGTGCTCA
TCTGCCCGTTGCCCCCGTTGCCGCAAGCTTTCTAGACCAT

BO27995.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ax1-RA 309 CG34270-PA 1..306 17..322 1530 100 Plus
Cpr65Ax2-RB 309 CG18777-PB 1..306 17..322 1530 100 Plus
Cpr65Ax2-RA 309 CG18777-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ax1-RA 389 CG34270-RA 49..354 17..322 1530 100 Plus
Cpr65Ax2-RB 732 CG18777-RB 48..353 17..322 1530 100 Plus
Cpr65Ax2-RA 388 CG18777-RA 48..353 17..322 1530 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6147566..6147761 322..127 980 100 Minus
3L 28110227 3L 6150437..6150632 322..127 980 100 Minus
3L 28110227 3L 6147830..6147939 126..17 550 100 Minus
3L 28110227 3L 6150701..6150810 126..17 550 100 Minus
3L 28110227 3L 6133157..6133244 322..235 320 90.9 Minus
3L 28110227 3L 6134842..6134925 318..235 315 91.7 Minus
3L 28110227 3L 6130558..6130641 318..235 300 90.5 Minus
3L 28110227 3L 6145140..6145289 158..307 300 80 Plus
3L 28110227 3L 6137725..6137830 313..208 290 84.9 Minus
3L 28110227 3L 6136387..6136470 318..235 270 88.1 Minus
3L 28110227 3L 6139425..6139574 307..158 225 76.7 Minus
3L 28110227 3L 6146961..6147032 250..321 225 87.5 Plus
3L 28110227 3L 6149832..6149903 250..321 225 87.5 Plus
3L 28110227 3L 6143800..6143871 236..307 195 84.7 Plus
3L 28110227 3L 6151536..6151619 211..294 180 81 Plus
2R 25286936 2R 12408286..12408333 259..306 180 91.7 Plus
Blast to na_te.dros performed on 2014-11-26 15:02:19 has no hits.

BO27995.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:53:06 Download gff for BO27995.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ax1-RA 46..351 17..324 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:08 Download gff for BO27995.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ax1-RA 49..354 17..324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:07 Download gff for BO27995.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ax2-RA 48..353 17..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:07 Download gff for BO27995.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6147564..6147761 127..324 98 <- Minus
3L 6147830..6147939 17..126 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:08 Download gff for BO27995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6140664..6140861 127..324 98 <- Minus
arm_3L 6140930..6141039 17..126 100   Minus

BO27995.pep Sequence

Translation from 16 to 340

> BO27995.pep
MKFAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEG
VLKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAP
VAASFLDH

BO27995.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ax1-PA 102 CG34270-PA 1..102 1..102 515 100 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..102 1..102 515 100 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..102 1..102 515 100 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..105 1..102 309 60 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..105 1..102 309 60 Plus