Clone BO28085 Report

Search the DGRC for BO28085

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:280
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A2-RA
Protein status:BO28085.pep: Imported from assembly
Sequenced Size:184

Clone Sequence Records

BO28085.complete Sequence

184 bp assembled on 2011-06-24

GenBank Submission: KX795024

> BO28085.complete
GAAGTTATCAGTCGACATGCATTTCTATCATTTAAATGCGCTTTGCGTGA
TTATTTTATTAGATTTGACCAACGCGTTGAATCCAAAGGAAGGATCTACT
TTTTGTGTACCTAACTATAGAGGATGGTGCTGGGATAGCAATGCGAATGT
TTGGACCTACGGAAGAGCAAGCTTTCTAGACCAT

BO28085.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-RA 153 CG42473-PA 1..150 17..166 750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-RA 337 CG42473-RA 16..166 16..166 755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837728..11837878 16..166 755 100 Plus
Blast to na_te.dros performed 2014-11-26 15:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 383..475 112..21 102 58.1 Minus

BO28085.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-24 09:01:42 Download gff for BO28085.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..166 17..168 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:59:25 Download gff for BO28085.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..166 17..168 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:38:51 Download gff for BO28085.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..166 17..168 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:38:51 Download gff for BO28085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837729..11837878 17..168 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:59:25 Download gff for BO28085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11837729..11837878 17..168 98   Plus

BO28085.pep Sequence

Translation from 16 to 184

> BO28085.pep
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
ASFLDH

BO28085.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-PA 50 CG42473-PA 1..50 1..50 293 100 Plus
Sfp33A4-PA 50 CG42604-PA 1..50 1..50 138 48 Plus